DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10154 and Peritrophin-A

DIOPT Version :9

Sequence 1:NP_001189089.1 Gene:CG10154 / 39509 FlyBaseID:FBgn0036361 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_523418.1 Gene:Peritrophin-A / 33023 FlyBaseID:FBgn0022770 Length:230 Species:Drosophila melanogaster


Alignment Length:239 Identity:54/239 - (22%)
Similarity:87/239 - (36%) Gaps:64/239 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 QVCT--YMEEVQC-------LPTC-ESFRLSSFCYDNTCTKYVLCYYGKPVLRQCHDGLQYNN-- 168
            |||:  .:..:.|       .|.| |.:.:.::.:...|.::.||..|...|..|.:||.::.  
  Fly     5 QVCSVLILAWIACGHALAVGSPECPEKYGVQAYAHTENCDQFFLCTNGTLTLETCENGLLFDGKG 69

  Fly   169 -ATDRCDFPEYVDCVANDCSATFQPEDI----------IYLGSKASCSKYYVCSNGHPWEQQCAP 222
             ..:.|::...|||....    :.|..|          :|..||...:.|..|::|.|.||.|..
  Fly    70 AVHNHCNYNWAVDCKGRQ----WDPTPISTPACEYQFGLYAVSKDCSTTYIKCAHGEPHEQDCDA 130

  Fly   223 GLAYNPSCKCCDFAKNV--NCTIDAVARNILPYSRTPLRRADIKCPL------MGTHFFP----- 274
            ||||:.....|::...:  :|..:||              ...|||.      :...|:|     
  Fly   131 GLAYDERIHGCNWPDQLLEHCNPEAV--------------VGFKCPTKVDPNSVAARFWPFPRFP 181

  Fly   275 -----HKSRRDAYYYCVEGRGVTLDCTPGLYYDPKVEDCRRPEF 313
                 |:     ...||||....:.|.....:|.....|..||:
  Fly   182 VAGDCHR-----LITCVEGHPRLISCGEDKVFDEHTLTCEDPEY 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10154NP_001189089.1 CBM_14 130..180 CDD:279884 11/53 (21%)
CBM_14 197..239 CDD:279884 15/41 (37%)
ChtBD2 263..311 CDD:214696 13/63 (21%)
Peritrophin-ANP_523418.1 CBM_14 36..83 CDD:279884 10/46 (22%)
CBM_14 103..147 CDD:279884 15/43 (35%)
ChtBD2 179..218 CDD:214696 8/43 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.