DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10154 and obst-A

DIOPT Version :9

Sequence 1:NP_001189089.1 Gene:CG10154 / 39509 FlyBaseID:FBgn0036361 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster


Alignment Length:204 Identity:56/204 - (27%)
Similarity:77/204 - (37%) Gaps:40/204 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 FCYDNTCTKYVLCYYGKPVLRQCHDGLQY---NNATDRCDFPEYVDCVANDCSATFQPEDIIYLG 199
            |..:..|.|:.:|..|....:.|.|||.:   |...::||.|..|||  .|.:...:|:...|..
  Fly    32 FADEVQCDKFYVCDDGVAKAKLCPDGLVFDPLNRKFNKCDQPFNVD
C--EDRTELQEPKSSKYCP 94

  Fly   200 SK---------ASCSKYYVCSNGHPWEQQCAPGL---AYNPSCKCCDFAKNVNCTIDAVARNILP 252
            .|         |.|:.:|.|..|...|.:|..||   .|:.:|...|.||...|.         |
  Fly    95 RKNGFFAHPDPAVCNIFYNCIEGDALETKCTVGLHFDEYSGTCVWPDTAKREGCN---------P 150

  Fly   253 YSRTPLRRADIKCP----------LMGTH-FFPHKSRRDAYYYCVEGRGV-TLDCTPGLYYDPKV 305
            ..||  ......||          .:.|| .:||.:....:|.|:.|... .|.|..|..|:...
  Fly   151 EQRT--SETGFVCPKDQPKTDDRGQVVTHPKYPHPTDCQKFYVCLNGEDPRDLGCQLGEVYNDAT 213

  Fly   306 EDCRRPEFV 314
            |.|..||.|
  Fly   214 EMCDAPENV 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10154NP_001189089.1 CBM_14 130..180 CDD:279884 13/44 (30%)
CBM_14 197..239 CDD:279884 16/53 (30%)
ChtBD2 263..311 CDD:214696 15/59 (25%)
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 13/44 (30%)
CBM_14 95..143 CDD:366726 13/47 (28%)
CBM_14 180..225 CDD:366726 14/43 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444145
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.