DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10154 and Mur18B

DIOPT Version :10

Sequence 1:NP_648646.2 Gene:CG10154 / 39509 FlyBaseID:FBgn0036361 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_573364.1 Gene:Mur18B / 32912 FlyBaseID:FBgn0030999 Length:481 Species:Drosophila melanogaster


Alignment Length:170 Identity:37/170 - (21%)
Similarity:55/170 - (32%) Gaps:61/170 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 SATFQPEDIIYLGSKASCSKYYVCSNGHPWEQQCAPGLAYNPSCKC----------CDFAKNVNC 241
            ||..:||         |.|.....|...|.....||   ..|:.||          .|.::..||
  Fly   247 SAPAEPE---------SSSTSSAASPSTPAGTTIAP---TPPTFKCQTAGLFPHISGDCSRYHNC 299

  Fly   242 TIDAVARNILPYSRTPLRRADIKCPLMGTHFFPHKSR--RD----------------------AY 282
            .::.|.|.        |:..::.||.: |.|.|...|  ||                      .|
  Fly   300 LLNPVLRQ--------LQDIELTCPEL-TVFSPSLGRCVRDLAECQVESFPCLSVGRFAGIDETY 355

  Fly   283 YY-CVEG-----RGVTLDCTPGLYYDPKVEDCRRPEFVGV 316
            || ||..     ....:.|:.|..::|.:..|.|.::..:
  Fly   356 YYSCVASLQGGFHKFIVRCSSGQRFEPLIGGCWRYDWTQI 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10154NP_648646.2 CBM_14 130..181 CDD:426342
CBM_14 197..239 CDD:426342 10/51 (20%)
ChtBD2 263..311 CDD:214696 17/77 (22%)
Mur18BNP_573364.1 PTZ00436 <120..249 CDD:185616 1/1 (100%)
ChtBD2 278..329 CDD:214696 14/59 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.