Sequence 1: | NP_001189089.1 | Gene: | CG10154 / 39509 | FlyBaseID: | FBgn0036361 | Length: | 316 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_728731.1 | Gene: | obst-I / 317966 | FlyBaseID: | FBgn0052304 | Length: | 219 | Species: | Drosophila melanogaster |
Alignment Length: | 201 | Identity: | 45/201 - (22%) |
---|---|---|---|
Similarity: | 74/201 - (36%) | Gaps: | 55/201 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 48 DMYENTQINVCGNVADGVYLPYVGNCSKYIECENNTIKEVGSCLDLAKDNPDICDPNKSCELGYD 112
Fly 113 PVLQV--C---TYMEEVQCL-----PTCESFRLSSFCYDNTCTK-YVLCYYGKPVLRQCHDGLQY 166
Fly 167 --------NNATDRCDFPEYVDCVANDCSATFQPEDIIYLGSKASCSKYYVC-SNGHPWEQ-QCA 221
Fly 222 PGLAYN 227 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10154 | NP_001189089.1 | CBM_14 | 130..180 | CDD:279884 | 14/58 (24%) |
CBM_14 | 197..239 | CDD:279884 | 12/33 (36%) | ||
ChtBD2 | 263..311 | CDD:214696 | |||
obst-I | NP_728731.1 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D487374at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |