DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10154 and obst-I

DIOPT Version :9

Sequence 1:NP_001189089.1 Gene:CG10154 / 39509 FlyBaseID:FBgn0036361 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_728731.1 Gene:obst-I / 317966 FlyBaseID:FBgn0052304 Length:219 Species:Drosophila melanogaster


Alignment Length:201 Identity:45/201 - (22%)
Similarity:74/201 - (36%) Gaps:55/201 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DMYENTQINVCGNVADGVYLPYVGNCSKYIECENNTIKEVGSCLDLAKDNPDICDPNKSCELGYD 112
            |.|.|..|..|.:             :....|.|:   ::|.| .:|.:..:.|    .|:   |
  Fly    42 DYYFNETIQACVS-------------TDTTSCTNH---QIGKC-PMATEMDEFC----VCK---D 82

  Fly   113 PVLQV--C---TYMEEVQCL-----PTCESFRLSSFCYDNTCTK-YVLCYYGKPVLRQCHDGLQY 166
            ..||:  |   ||.:..:.:     ..|:.....|.|.::|.:. :.||..||..|..|..|..:
  Fly    83 KHLQIWKCPEGTYFDANRLVCRVGSVECQDDYTPSPCPNSTASDVFCLCIDGKWHLNYCPTGFTF 147

  Fly   167 --------NNATDRCDFPEYVDCVANDCSATFQPEDIIYLGSKASCSKYYVC-SNGHPWEQ-QCA 221
                    |..:|..:.|          |::.:.:.:...|..|.||.||.| ..|...|. :|:
  Fly   148 DDELQICLNTGSDDDELP----------SSSGKCQRLGLFGDPADCSGYYHCREKGSDIEYFRCS 202

  Fly   222 PGLAYN 227
            .|..:|
  Fly   203 VGTIFN 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10154NP_001189089.1 CBM_14 130..180 CDD:279884 14/58 (24%)
CBM_14 197..239 CDD:279884 12/33 (36%)
ChtBD2 263..311 CDD:214696
obst-INP_728731.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.