DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10154 and Mur2B

DIOPT Version :10

Sequence 1:NP_648646.2 Gene:CG10154 / 39509 FlyBaseID:FBgn0036361 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_569927.1 Gene:Mur2B / 31111 FlyBaseID:FBgn0025390 Length:1795 Species:Drosophila melanogaster


Alignment Length:231 Identity:52/231 - (22%)
Similarity:79/231 - (34%) Gaps:84/231 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 FCYDNTCTK--------------YVLCYYGKP---VLRQCHDGLQYNNATDRC--DFPEY-VDCV 182
            |.|:|.|::              |.:|   ||   :..:|.....:|.::.||  ..|:: .|..
  Fly    84 FDYNNRCSRNYIGIKPHPDQQQYYYVC---KPDCVIFSKCRGLESFNASSGRCVQHVPQHRPDHR 145

  Fly   183 ANDCSATFQ---PEDIIYLGSKASCSKYYVCSNG--HPW-------------EQQCAPG------ 223
            ...|....:   |.|         |..||.|...  .||             |::|.||      
  Fly   146 PPQCQKEGRFPHPHD---------CKVYYRCDKNRTQPWLFACPAGTIFSPVERKCLPGDQCPST 201

  Fly   224 -----LAYNP-SC-----KCCD---FAKNVNCTIDAVARNILPYSRTPLRRADIKCPLMGTHFFP 274
                 .:|.| :|     :|.:   |....:|.:....|  |..|.|.| :...|||  |::.|.
  Fly   202 EISDSGSYIPQNCELKFPECAEEGTFRSPTDCALYYTCR--LQESGTYL-QTRFKCP--GSNSFD 261

  Fly   275 -------HKSRRDAYYYCVEGRGVTLDCTPGLYYDP 303
                   .:|..|.:.: |.| .|.:...|..||.|
  Fly   262 LERKLCRPRSEVDCFDF-VPG-PVQVPYAPQPYYPP 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10154NP_648646.2 CBM_14 130..181 CDD:426342 13/62 (21%)
CBM_14 197..239 CDD:426342 15/76 (20%)
ChtBD2 263..311 CDD:214696 14/48 (29%)
Mur2BNP_569927.1 ChtBD2 88..136 CDD:214696 10/50 (20%)
CBM_14 150..197 CDD:426342 12/55 (22%)
CBM_14 221..275 CDD:426342 14/58 (24%)

Return to query results.
Submit another query.