DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10154 and Mur2B

DIOPT Version :9

Sequence 1:NP_001189089.1 Gene:CG10154 / 39509 FlyBaseID:FBgn0036361 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001284789.1 Gene:Mur2B / 31111 FlyBaseID:FBgn0025390 Length:1795 Species:Drosophila melanogaster


Alignment Length:231 Identity:52/231 - (22%)
Similarity:79/231 - (34%) Gaps:84/231 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 FCYDNTCTK--------------YVLCYYGKP---VLRQCHDGLQYNNATDRC--DFPEY-VDCV 182
            |.|:|.|::              |.:|   ||   :..:|.....:|.::.||  ..|:: .|..
  Fly    84 FDYNNRCSRNYIGIKPHPDQQQYYYVC---KPDCVIFSKCRGLESFNASSGRCVQHVPQHRPDHR 145

  Fly   183 ANDCSATFQ---PEDIIYLGSKASCSKYYVCSNG--HPW-------------EQQCAPG------ 223
            ...|....:   |.|         |..||.|...  .||             |::|.||      
  Fly   146 PPQCQKEGRFPHPHD---------CKVYYRCDKNRTQPWLFACPAGTIFSPVERKCLPGDQCPST 201

  Fly   224 -----LAYNP-SC-----KCCD---FAKNVNCTIDAVARNILPYSRTPLRRADIKCPLMGTHFFP 274
                 .:|.| :|     :|.:   |....:|.:....|  |..|.|.| :...|||  |::.|.
  Fly   202 EISDSGSYIPQNCELKFPECAEEGTFRSPTDCALYYTCR--LQESGTYL-QTRFKCP--GSNSFD 261

  Fly   275 -------HKSRRDAYYYCVEGRGVTLDCTPGLYYDP 303
                   .:|..|.:.: |.| .|.:...|..||.|
  Fly   262 LERKLCRPRSEVDCFDF-VPG-PVQVPYAPQPYYPP 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10154NP_001189089.1 CBM_14 130..180 CDD:279884 13/61 (21%)
CBM_14 197..239 CDD:279884 15/76 (20%)
ChtBD2 263..311 CDD:214696 14/48 (29%)
Mur2BNP_001284789.1 ChtBD2 88..136 CDD:214696 10/50 (20%)
CBM_14 150..197 CDD:279884 12/55 (22%)
CBM_14 221..275 CDD:279884 14/58 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.