DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10154 and cpg-2

DIOPT Version :9

Sequence 1:NP_001189089.1 Gene:CG10154 / 39509 FlyBaseID:FBgn0036361 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_498551.3 Gene:cpg-2 / 175991 WormBaseID:WBGene00015102 Length:524 Species:Caenorhabditis elegans


Alignment Length:401 Identity:73/401 - (18%)
Similarity:117/401 - (29%) Gaps:157/401 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GEGLNVQDKDIYDMYENTQINVCGNVADGVYLPYVGNCSK-YIECENNTIKEVG----------- 88
            |||......:.....|.|..|||.|:.||.|..  |.|:. |..|..||.:.:.           
 Worm   116 GEGSGEASGEGSGSGEETVENVCENLEDGAYSS--GGCTTYYFFCTTNTARFLSCPTPLFYDADS 178

  Fly    89 ------SCLDLAKDNPDICD--------------------------------------------- 102
                  |.::..|::..|.|                                             
 Worm   179 QKCIWKSLVEECKEDLTITDGSGETSGEGSGEASGEASGEGSGEASGESSGQGSGEASGEGSGEL 243

  Fly   103 ------------PNKSC-------------------ELGYDPVLQVCTYMEEV-QCL------PT 129
                        ||..|                   .|.::|.:.||.:..:| :|.      ||
 Worm   244 EPTCEGKADGIHPNGVCSTNFLTCSGGIARIMDCPASLVFNPTILVCDWPRDVAECAGLPTPQPT 308

  Fly   130 CESFRLSSFCYDNTCTKYVLCYYGKPVLRQCHDGLQYNNATDRCDFPEYVDCVANDCSATFQPED 194
            ||..  ..|.:....:.:..|..|:.::..|..||:::.:|.|||:...|    ::|..|...|.
 Worm   309 CEED--GYFSFGQCSSSFTACTNGRAIVMFCPAGLKFSESTVRCDYESNV----SECQETSGEES 367

  Fly   195 IIYLGSKA--------------------------------------SCS-KYYVCSNGHPWEQQC 220
            ....|.::                                      .|| :...|.|||....:|
 Worm   368 GEASGEQSGEGSGEASGEASGESSGEGSGVEEQNQCVGLDNGLHAIGCSPRVLSCQNGHVDIFEC 432

  Fly   221 APGLAYNPSCKCCDFAK-NVNCTIDAVARNILPYSRTPLRRADIKCPLMGTHFFPHKSRRDAYYY 284
            ...|.:|.....||:.: ::.|.|:    :.:....||:...|  |...|  .|........|:.
 Worm   433 PSSLVFNDQSLICDYPQTSLKCLIE----DTILIDETPIAAFD--CSTDG--LFSDGLCSATYHQ 489

  Fly   285 CVEGRGVTLDC 295
            |..|:.:...|
 Worm   490 CTAGQLINFTC 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10154NP_001189089.1 CBM_14 130..180 CDD:279884 12/49 (24%)
CBM_14 197..239 CDD:279884 12/81 (15%)
ChtBD2 263..311 CDD:214696 7/33 (21%)
cpg-2NP_498551.3 CBM_14 24..76 CDD:279884
CBM_14 138..190 CDD:279884 12/53 (23%)
ChtBD2 245..293 CDD:214696 7/47 (15%)
CBM_14 311..359 CDD:279884 11/53 (21%)
CBM_14 403..454 CDD:279884 11/50 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157846
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.