Sequence 1: | NP_001189089.1 | Gene: | CG10154 / 39509 | FlyBaseID: | FBgn0036361 | Length: | 316 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_498551.3 | Gene: | cpg-2 / 175991 | WormBaseID: | WBGene00015102 | Length: | 524 | Species: | Caenorhabditis elegans |
Alignment Length: | 401 | Identity: | 73/401 - (18%) |
---|---|---|---|
Similarity: | 117/401 - (29%) | Gaps: | 157/401 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 36 GEGLNVQDKDIYDMYENTQINVCGNVADGVYLPYVGNCSK-YIECENNTIKEVG----------- 88
Fly 89 ------SCLDLAKDNPDICD--------------------------------------------- 102
Fly 103 ------------PNKSC-------------------ELGYDPVLQVCTYMEEV-QCL------PT 129
Fly 130 CESFRLSSFCYDNTCTKYVLCYYGKPVLRQCHDGLQYNNATDRCDFPEYVDCVANDCSATFQPED 194
Fly 195 IIYLGSKA--------------------------------------SCS-KYYVCSNGHPWEQQC 220
Fly 221 APGLAYNPSCKCCDFAK-NVNCTIDAVARNILPYSRTPLRRADIKCPLMGTHFFPHKSRRDAYYY 284
Fly 285 CVEGRGVTLDC 295 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10154 | NP_001189089.1 | CBM_14 | 130..180 | CDD:279884 | 12/49 (24%) |
CBM_14 | 197..239 | CDD:279884 | 12/81 (15%) | ||
ChtBD2 | 263..311 | CDD:214696 | 7/33 (21%) | ||
cpg-2 | NP_498551.3 | CBM_14 | 24..76 | CDD:279884 | |
CBM_14 | 138..190 | CDD:279884 | 12/53 (23%) | ||
ChtBD2 | 245..293 | CDD:214696 | 7/47 (15%) | ||
CBM_14 | 311..359 | CDD:279884 | 11/53 (21%) | ||
CBM_14 | 403..454 | CDD:279884 | 11/50 (22%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C160157846 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D487374at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR23301 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.950 |