DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10154 and cpg-1

DIOPT Version :9

Sequence 1:NP_001189089.1 Gene:CG10154 / 39509 FlyBaseID:FBgn0036361 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001021159.1 Gene:cpg-1 / 175586 WormBaseID:WBGene00000465 Length:584 Species:Caenorhabditis elegans


Alignment Length:233 Identity:52/233 - (22%)
Similarity:74/233 - (31%) Gaps:74/233 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 CGNVADGVYLPYVGNCS-KYIECENNTIKEVGSCLDLAKDNPDICDPNKSCELGYDPVLQVCTYM 121
            |....||:|.  :|.|| :::.|... |..:..|               ..:|.|||.:..|.|.
 Worm    61 CSTKEDGLYA--IGGCSPQFLTCSGG-ISRIMDC---------------PADLIYDPRIVACEYS 107

  Fly   122 EEV-QCLPTCESFRLSSFCY---DNTCTKYVLCYYGKPVLRQCHDGLQ----------------- 165
            ..| ||....:....:...|   :.|...|.      ||........:                 
 Worm   108 YNVPQCGGVPQDVTSTQEAYPSEETTVNPYA------PVEEATTTPAEDVTVPEETTTEAYAPVD 166

  Fly   166 -YNNATDRCDFPEYVDCVAN----------DCSATFQP-------------EDIIYLGSKASCSK 206
             |:..|...|.|..|:..|:          ...|..:|             .|..|  |...||.
 Worm   167 DYSTTTPAEDVPVPVETTASPYAPIVPYTTGAPAADEPVTRSAVTKSCVGKADGFY--SFGECSD 229

  Fly   207 YY-VCSNGHPWEQQCAPGLAYNPSCKCCDFAKNV-NCT 242
            :| .||||:....||...||::.:...||:..|| .||
 Worm   230 HYTACSNGYLIPMQCPARLAFDEARVICDYVMNVPECT 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10154NP_001189089.1 CBM_14 130..180 CDD:279884 9/70 (13%)
CBM_14 197..239 CDD:279884 15/42 (36%)
ChtBD2 263..311 CDD:214696
cpg-1NP_001021159.1 CBM_14 61..113 CDD:279884 17/69 (25%)
CBM_14 214..266 CDD:279884 18/53 (34%)
CBM_14 <537..576 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157847
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.