DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10154 and CG43294

DIOPT Version :9

Sequence 1:NP_001189089.1 Gene:CG10154 / 39509 FlyBaseID:FBgn0036361 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001356903.1 Gene:CG43294 / 12798218 FlyBaseID:FBgn0262986 Length:143 Species:Drosophila melanogaster


Alignment Length:134 Identity:28/134 - (20%)
Similarity:41/134 - (30%) Gaps:49/134 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 PYVGNCSKYIECENNTIKEVGSCLDLAKDNPDICDPNKSCELGYDPVLQVCTYMEEVQC------ 126
            |:..:|.:|.|..         .||        |.|    |..::..|..|.....|.|      
  Fly    28 PFPNDCHRYYETR---------LLD--------CPP----EFYWNSQLLQCNSQTPVGCSSIDPI 71

  Fly   127 ------------LPTCESFRLSSFC---------YDNTCTKYVLCYYGKPVLRQCHDGLQYNNAT 170
                        :...|:..|:..|         |...|||::.|.| .|.:..|...|.:|:..
  Fly    72 TNWNNSYPNSPPIKEPENSDLTKLCENKLNQLIPYPADCTKFIRCDY-LPFVMCCPQYLYWNSQL 135

  Fly   171 DRCD 174
            ..||
  Fly   136 LTCD 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10154NP_001189089.1 CBM_14 130..180 CDD:279884 15/54 (28%)
CBM_14 197..239 CDD:279884
ChtBD2 263..311 CDD:214696
CG43294NP_001356903.1 CBM_14 96..139 CDD:307643 11/43 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.