DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10154 and LOC110437948

DIOPT Version :9

Sequence 1:NP_001189089.1 Gene:CG10154 / 39509 FlyBaseID:FBgn0036361 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_021322240.1 Gene:LOC110437948 / 110437948 -ID:- Length:195 Species:Danio rerio


Alignment Length:213 Identity:43/213 - (20%)
Similarity:64/213 - (30%) Gaps:56/213 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 PVLQVC-TYMEEVQCLPTCESFRLSSFCYDNTCTKYVLCYYG--KPVLRQCHDGLQYNNATDRCD 174
            |.|.:| .:.:...|....||.........:.|.:...|..|  :||  .||.|....       
Zfish     2 PRLNLCHNFTQRFYCTEKAESPTPIDGITGHVCPEGHYCPPGATRPV--PCHSGTFVT------- 57

  Fly   175 FPEYVDCVANDCSATFQPEDIIYLGSKASCSKYYVCSNGHPWEQQCAPGLAYNP--------SCK 231
            .|:...|.|  |:|.:...|    |.:..|...:.|..|..::.:..|...|:|        .|:
Zfish    58 VPQASQCWA--CTAGWYCAD----GGRLLCPAGFYCPEGTGYDIRPCPAGTYSPDSGLISLSECR 116

  Fly   232 CCDFAKNVNCTID--------------AVARNILPYSRTPLRRADIKCPLMGTHFFPHKSRRDAY 282
            .||...  .|::.              ....||.|...|........||:  .||          
Zfish   117 ACDGGH--YCSLQNSSSVTGQCSEGYYCAQGNISPQPYTQNTGVGGLCPV--GHF---------- 167

  Fly   283 YYCVEGRGVTLDCTPGLY 300
              |.:|......|..|.:
Zfish   168 --CPQGTAQPQPCPEGTF 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10154NP_001189089.1 CBM_14 130..180 CDD:279884 11/51 (22%)
CBM_14 197..239 CDD:279884 10/49 (20%)
ChtBD2 263..311 CDD:214696 8/38 (21%)
LOC110437948XP_021322240.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.