DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10154 and Gm30500

DIOPT Version :9

Sequence 1:NP_001189089.1 Gene:CG10154 / 39509 FlyBaseID:FBgn0036361 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_017171830.1 Gene:Gm30500 / 102632425 MGIID:5589659 Length:614 Species:Mus musculus


Alignment Length:262 Identity:60/262 - (22%)
Similarity:83/262 - (31%) Gaps:79/262 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 CDPNKSCELGYDPVL--QVCTYMEEV------QCLPT-----CESFRLSS---------FC---- 139
            |.....|.:|....|  .|.|:.:.:      :|||.     |.:..||:         ||    
Mouse    97 CPVGHFCPVGLGMALPCPVGTFSDRMFLSMSSECLPCPPGHFCAASGLSAPSGPCAPGYFCLSGV 161

  Fly   140 ----------YDNTCTKYVLCYYGKPVLRQCHDGLQYNNATDRCDFPEYVDCVANDCSATFQ-PE 193
                      :...|.:...|..|..:.:.|..| .|.:...:      |.|.  .|.|.:. ||
Mouse   162 SSPTPTGRSGHGGPCPQGHFCPRGTSLPQPCRAG-SYGSLLGQ------VSCF--PCPAGYYCPE 217

  Fly   194 DII-YLGSKASCSKYYVCSNG--HPWEQQCAPGLAYNP--------SCKCC---DFAKNVNCT-- 242
            :|. |.|  ..|...:.|..|  |..:..|..|. |||        ||..|   .:....|.|  
Mouse   218 NITSYSG--YPCPAGFYCPRGTKHAAQFPCPRGY-YNPDPLTHSLDSCLPCPPGHYCGQENLTKP 279

  Fly   243 ---IDA------VARNILPYSRTPLRRADIKCPLMGTHFFPHKSRRDAYYYCVEGRGVTLDCTPG 298
               .||      .|.|..|:........:..||...|     ..:..|..||.||....:.||||
Mouse   280 SGPCDAGWYCVSAAWNARPFDLDNYTSTNCLCPATAT-----GGKCPAGSYCPEGSPEPIPCTPG 339

  Fly   299 LY 300
            .:
Mouse   340 SF 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10154NP_001189089.1 CBM_14 130..180 CDD:279884 11/72 (15%)
CBM_14 197..239 CDD:279884 14/54 (26%)
ChtBD2 263..311 CDD:214696 12/38 (32%)
Gm30500XP_017171830.1 TNFRSF 394..518 CDD:389949
CRD1 394..411 CDD:276900
CRD2 414..451 CDD:276900
CRD3 453..506 CDD:276900
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.