DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14105 and TMEM25

DIOPT Version :10

Sequence 1:NP_648644.1 Gene:CG14105 / 39507 FlyBaseID:FBgn0036359 Length:185 Species:Drosophila melanogaster
Sequence 2:XP_005271760.1 Gene:TMEM25 / 84866 HGNCID:25890 Length:382 Species:Homo sapiens


Alignment Length:46 Identity:14/46 - (30%)
Similarity:28/46 - (60%) Gaps:4/46 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VLDSIFNPLELSSL---QTNNLIPAESDLKDEEPDTQAIK-ASREL 56
            ::.|..|.|:|:::   :.|..:|:...|.|..||::|:| |.|::
Human   276 LISSDSNNLKLNNVRLPRENMSLPSNLQLNDLTPDSRAVKPADRQM 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14105NP_648644.1 TPR repeat 53..81 CDD:276809 1/4 (25%)
Spy 60..>142 CDD:443119
TPR repeat 85..115 CDD:276809
TMEM25XP_005271760.1 Ig 27..118 CDD:472250
Ig strand B 48..52 CDD:409353
Ig strand C 62..66 CDD:409353
Ig strand E 91..94 CDD:409353
Ig strand F 104..109 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.