DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14105 and Tmem25

DIOPT Version :10

Sequence 1:NP_648644.1 Gene:CG14105 / 39507 FlyBaseID:FBgn0036359 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001102998.1 Gene:Tmem25 / 689172 RGDID:1596132 Length:365 Species:Rattus norvegicus


Alignment Length:176 Identity:41/176 - (23%)
Similarity:67/176 - (38%) Gaps:45/176 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PLELSSLQ-TNNLIPA-----ESDLKDE-EPDTQAIKASRELELKAIALSESG---------ELD 70
            ||..::|: |..|:||     :.:|..: :..|.|.:|.||.|..|.....:|         .||
  Rat     4 PLSQATLRHTLLLLPALLSSGQGELAPQIDGQTWAERALRENEHHAFTCRVAGGSATPRLAWYLD 68

  Fly    71 GALELFQQSLNLAQRASVLNNRAQTLRL-AKRDEEALDDLNKALELANDQQTRTKCHAHCQRGVL 134
            |.|:....|..|:......:....|..: |:|.:.   :||.:|:   |..:....:|.....|.
  Rat    69 GQLQKATTSRLLSVGGDAFSGGTSTFTVTAQRSQH---ELNCSLQ---DPGSGRPANASVILNVQ 127

  Fly   135 YRKLDNLEAARADFEAAAQLGSKFAREQ----------LVEINPYA 170
            ::            ...||:|:|:...|          ||..||.|
  Rat   128 FK------------PEIAQVGAKYQEAQGPGLLVVLFALVRANPPA 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14105NP_648644.1 TPR repeat 53..81 CDD:276809 10/36 (28%)
Spy 60..>142 CDD:443119 17/91 (19%)
TPR repeat 85..115 CDD:276809 6/30 (20%)
Tmem25NP_001102998.1 Ig 27..118 CDD:472250 22/96 (23%)
Ig strand B 48..52 CDD:409353 1/3 (33%)
Ig strand C 62..66 CDD:409353 0/3 (0%)
Ig strand E 91..94 CDD:409353 0/2 (0%)
Ig strand F 104..109 CDD:409353 2/4 (50%)

Return to query results.
Submit another query.