DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10222 and GPN3

DIOPT Version :9

Sequence 1:NP_001287060.1 Gene:CG10222 / 39504 FlyBaseID:FBgn0036356 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_013344.1 Gene:GPN3 / 850944 SGDID:S000004233 Length:272 Species:Saccharomyces cerevisiae


Alignment Length:274 Identity:94/274 - (34%)
Similarity:158/274 - (57%) Gaps:24/274 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 RYGQLIIGPPGSGKTTYCGEALKFYRELGRQVGVVNLDPANENMSYEPVLSVMELITVEDCMEHL 79
            |.|.:::||.|:||:|:|...:...:.:||:..:||||||.|...||..:.:.:||:::|.||.:
Yeast     3 RVGVMVLGPAGAGKSTFCNSIISHMQTVGRRAHIVNLDPAAEATKYEFTIDIRDLISLDDVMEEM 67

  Fly    80 KLGPNGALMHCAEYLADHLEDWLLPALRKLSATYN--YFLFDCPGQVELYTHHNAMARIFERLER 142
            .|||||||::|.|||..:| |||...:    ..:|  |.:||||||:|||||...:..|...|.:
Yeast    68 DLGPNGALIYCFEYLLKNL-DWLDEEI----GDFNDEYLIFDCPGQIELYTHIPVLPNIVRHLTQ 127

  Fly   143 E-RYSLVTVNLIDSHYCSEPAKFIATLLMALNTMLRMSLPHVNVLSKADLLK----KHETKLHFN 202
            : .::|....|:::.:..:.:||.:..|.|::.|:.:.|||:|||||.||:|    |.:.|...|
Yeast   128 QLNFNLCATYLLEAPFVIDSSKFFSGALSAMSAMILLELPHINVLSKLDLIKGDINKKKLKRFLN 192

  Fly   203 VDYYTDVLDLKYLLDKLD--DDPAMRKYRKLNAAICSMVEDYALVSFQLLDVFSTDSMLRLRNHI 265
            .|        ..||.:.:  :..:..|:.:||..|.::|:|:.:|.|..|:..:.||:..:.:::
Yeast   193 PD--------AMLLMETEGMNQASNPKFLRLNQCIANLVDDFGMVQFLPLESNNPDSIETILSYV 249

  Fly   266 DKANGYVYKAGEEQ 279
            |....:.  .|:||
Yeast   250 DDITQWA--EGQEQ 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10222NP_001287060.1 Gem1 19..193 CDD:224025 70/176 (40%)
ATP_bind_1 20..271 CDD:281079 89/259 (34%)
GPN3NP_013344.1 GPN3 5..251 CDD:349781 89/258 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.