DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10222 and AT4G12790

DIOPT Version :9

Sequence 1:NP_001287060.1 Gene:CG10222 / 39504 FlyBaseID:FBgn0036356 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001031621.1 Gene:AT4G12790 / 826891 AraportID:AT4G12790 Length:271 Species:Arabidopsis thaliana


Alignment Length:269 Identity:107/269 - (39%)
Similarity:161/269 - (59%) Gaps:16/269 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 YGQLIIGPPGSGKTTYCGEALKFYRELGRQVGVVNLDPANENMSYEPVLSVMELITVEDCMEHLK 80
            |.||:|||.||||:|||....:....:||.:.|||||||.|..:|...:.:.|||::||.||.||
plant     3 YAQLVIGPAGSGKSTYCSSLYEHCETIGRTMHVVNLDPAAEIFNYPVAMDIRELISLEDVMEDLK 67

  Fly    81 LGPNGALMHCAEYLADHLEDWLLPALRKLSATYNYFLFDCPGQVELYTHHNAMARIFERLERERY 145
            ||||||||:|.|||.|.|.||:...|...... :|.:||||||:||:||...:....|.|:::.:
plant    68 LGPNGALMYCMEYLEDSLHDWVDEELENYRDD-DYLIFDCPGQIELFTHVPVLKNFVEHLKQKNF 131

  Fly   146 SLVTVNLIDSHYCSEPAKFIATLLMALNTMLRMSLPHVNVLSKADLLKKHETKLHFNVDYYTDVL 210
            ::..|.|:||.:.::..|||:..:.:|..|:::.|||||:|||.|||:...     |:|.|.:. 
plant   132 NVCVVYLLDSQFITDVTKFISGCMSSLAAMIQLELPHVNILSKMDLLQDKS-----NIDDYLNP- 190

  Fly   211 DLKYLLDKLDD--DPAMRKYRKLNAAICSMVEDYALVSFQLLDVFSTDSMLRLRNHIDKANGYVY 273
            :.:.||.:|:.  .|   :|.|||.|:..||.:|.:|:|..:::....|:..:.:.||    ...
plant   191 EPRTLLAELNKRMGP---QYAKLNKALIEMVGEYGMVNFIPINLRKEKSIQYVLSQID----VCI 248

  Fly   274 KAGEEQTVN 282
            :.||:..||
plant   249 QFGEDADVN 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10222NP_001287060.1 Gem1 19..193 CDD:224025 80/173 (46%)
ATP_bind_1 20..271 CDD:281079 100/252 (40%)
AT4G12790NP_001031621.1 GPN3 3..245 CDD:349781 101/251 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D964931at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.