DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10222 and GPN3

DIOPT Version :9

Sequence 1:NP_001287060.1 Gene:CG10222 / 39504 FlyBaseID:FBgn0036356 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001157844.1 Gene:GPN3 / 51184 HGNCID:30186 Length:323 Species:Homo sapiens


Alignment Length:253 Identity:98/253 - (38%)
Similarity:148/253 - (58%) Gaps:13/253 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KTTYCGEALKFYRELGRQVGVVNLDPANENMSYEPVLSVMELITVEDCME--HLKLGPNGALMHC 90
            ::|||...::....|.|.|.|||||||.|:.:|..:..:.|||.|:|.||  .|:.||||.|:.|
Human    55 QSTYCATMVQHCEALNRSVQVVNLDPAAEHFNYSVMADIRELIEVDDVMEDDSLRFGPNGGLVFC 119

  Fly    91 AEYLADHLEDWLLPALRKLSATYNYFLFDCPGQVELYTHHNAMARIFERLERERYSLVTVNLIDS 155
            .||.|::. |||...|..:..  :|.|||||||:|||||...|.::.::||:..:.:..|.|:||
Human   120 MEYFANNF-DWLENCLGHVED--DYILFDCPGQIELYTHLPVMKQLVQQLEQWEFRVCGVFLVDS 181

  Fly   156 HYCSEPAKFIATLLMALNTMLRMSLPHVNVLSKADLLKKHETKLHFNVDYYTDVLDLKYLLDKLD 220
            .:..|..|||:.:|.||:.|:.:.:|.||:::|.|||.|...|   .::.:.|. |:..||:...
Human   182 QFMVESFKFISGILAALSAMISLEIPQVNIMTKMDLLSKKAKK---EIEKFLDP-DMYSLLEDST 242

  Fly   221 DDPAMRKYRKLNAAICSMVEDYALVSFQLLDVFSTDSMLRLRNHIDKANGYVYKAGEE 278
            .|...:|::||..|||.:::||::|.|...|....:||..:..|||.|..|    ||:
Human   243 SDLRSKKFKKLTKAICGLIDDYSMVRFLPYDQSDEESMNIVLQHIDFAIQY----GED 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10222NP_001287060.1 Gem1 19..193 CDD:224025 70/166 (42%)
ATP_bind_1 20..271 CDD:281079 95/244 (39%)
GPN3NP_001157844.1 ATP_bind_1 56..293 CDD:281079 95/243 (39%)
Gem1 56..249 CDD:224025 78/199 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D432496at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.