DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10222 and gpn3

DIOPT Version :9

Sequence 1:NP_001287060.1 Gene:CG10222 / 39504 FlyBaseID:FBgn0036356 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001007371.1 Gene:gpn3 / 100000326 ZFINID:ZDB-GENE-040724-141 Length:285 Species:Danio rerio


Alignment Length:272 Identity:106/272 - (38%)
Similarity:162/272 - (59%) Gaps:17/272 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PRYGQLIIGPPGSGKTTYCGEALKFYRELGRQVGVVNLDPANENMSYEPVLSVMELITVEDCME- 77
            |||.||::||.||||:|||...|:..:.|.|.|.|||||||.|:..|..:..:.|||.|:|.|| 
Zfish     2 PRYAQLVMGPAGSGKSTYCATMLEHCQALNRSVQVVNLDPAAEHFEYPVIADIRELIQVDDVMED 66

  Fly    78 -HLKLGPNGALMHCAEYLADHLEDWLLPALRKLSATYNYFLFDCPGQVELYTHHNAMARIFERLE 141
             .|:.||||.|:.|.||.:::. |||..:|..:..  :|.|||||||:|||||...|.::.|:|:
Zfish    67 DSLRFGPNGGLIFCMEYFSNNF-DWLEESLGHVED--DYILFDCPGQIELYTHLPVMKQLVEQLQ 128

  Fly   142 RERYSLVTVNLIDSHYCSEPAKFIATLLMALNTMLRMSLPHVNVLSKADLLKKHETKLHFNVDYY 206
            :..:.:..|.|:||.:..|..|||:.::.||:.|:.:.:|.||:::|.|||.....|   .::.|
Zfish   129 QWEFRVCGVFLVDSQFMVETFKFISGVMAALSAMVMLEIPQVNIMTKMDLLSPKAKK---EIEKY 190

  Fly   207 TDVLDLKYLLDKLDDDPAMR--KYRKLNAAICSMVEDYALVSFQLLDVFSTDSMLRLRNHIDKAN 269
            .|. |:..:::  |:..|:|  |:.||..|||.:::||::|.|...|....:.:..:..|||.:.
Zfish   191 LDP-DMYSMME--DNSVALRSKKFSKLTKAICGLIDDYSMVRFLPFDRTDEEGINIVLQHIDFSI 252

  Fly   270 GYVYKAGEEQTV 281
            .|    ||:..|
Zfish   253 QY----GEDLEV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10222NP_001287060.1 Gem1 19..193 CDD:224025 76/175 (43%)
ATP_bind_1 20..271 CDD:281079 97/254 (38%)
gpn3NP_001007371.1 Gem1 1..192 CDD:224025 83/195 (43%)
ATP_bind_1 8..254 CDD:281079 97/254 (38%)
Gly-Pro-Asn (GPN)-loop, involved in dimer interface. /evidence=ECO:0000250|UniProtKB:Q9UYR9 72..74 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..285
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D432496at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.