DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tox4 and Dsp1

DIOPT Version :9

Sequence 1:XP_012814066.1 Gene:tox4 / 395028 XenbaseID:XB-GENE-993803 Length:658 Species:Xenopus tropicalis
Sequence 2:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster


Alignment Length:109 Identity:32/109 - (29%)
Similarity:56/109 - (51%) Gaps:8/109 - (7%)


- Green bases have known domain annotations that are detailed below.


 Frog   245 HDEDMEDFRRITAPKNIIVEQAKKPKTPKKKKKKDPNEPQKPLSAYALFFRDTQAAIKGQNPNAT 309
            ::.:|:::   ..||..:|.:.|     |:|:.||||.|::.|||:..|..|.:..:|..||...
  Fly   245 YEAEMQNY---VPPKGAVVGRGK-----KRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFG 301

 Frog   310 FGEVSKIVASMWDSLGEEQKQVYKRKTEAAKKEYLKALALYKAN 353
            .|:::|.:...|..:..|.||.|:...|..|..|.:.:..||.:
  Fly   302 VGDIAKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEYKTS 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tox4XP_012814066.1 HMG-box 283..348 CDD:238037 19/64 (30%)
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 1/6 (17%)
HMGB-UBF_HMG-box 275..339 CDD:238686 19/63 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.