DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Poc1 and PAC1

DIOPT Version :10

Sequence 1:NP_001261799.1 Gene:Poc1 / 39502 FlyBaseID:FBgn0036354 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_014912.1 Gene:PAC1 / 854443 SGDID:S000005795 Length:494 Species:Saccharomyces cerevisiae


Alignment Length:253 Identity:58/253 - (22%)
Similarity:100/253 - (39%) Gaps:69/253 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RHFTGHSGGITQLRFGP--DGAQIATSSTDSTVILWNLNQAARCIRFASHSAPVNGVAWSPKGNL 74
            |...||...::.::...  :...||:.|.|.||.:|:.:.......|..||..|..:  ...|:.
Yeast   247 RSLLGHEHIVSAVKIWQKNNDVHIASCSRDQTVKIWDFHNGWSLKTFQPHSQWVRSI--DVLGDY 309

  Fly    75 VASAGHDRTVKI--WEPKLRGVSG--------------EFVAHSKAVR----SVD-FDSTG-HLM 117
            :.|..||.|:::  | |...|:|.              .|:..|..:|    |.| :.:.| ...
Yeast   310 IISGSHDTTLRLTHW-PSGNGLSVGTGHEFPIEKVKFIHFIEDSPEIRFRTPSTDRYKNWGMQYC 373

  Fly   118 LTASDDKSAKIWRV------ARRQFVSSFAQQN-----------NWVRSAKFSPNGKLVATASDD 165
            ::||.|::.|||.:      |.|..:.:....|           :|||.  .|..|:.:.:.:||
Yeast   374 VSASRDRTIKIWEIPLPTLMAHRAPIPNPTDSNFRCVLTLKGHLSWVRD--ISIRGQYLFSCADD 436

  Fly   166 KSVRIYDVDSGECVRTFT----------------EERAAPRQLAWHPWGNMLAVALGC 207
            ||||.:|:::|:|:..:.                :....|||:       |:...|.|
Yeast   437 KSVRCWDLNTGQCLHVWEKLHTGFVNCLDLDVDFDSNVTPRQM-------MVTGGLDC 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Poc1NP_001261799.1 WD40 <7..298 CDD:441893 58/253 (23%)
WD40 repeat 22..58 CDD:293791 8/37 (22%)
WD40 repeat 63..99 CDD:293791 10/51 (20%)
WD40 repeat 106..140 CDD:293791 12/45 (27%)
WD40 repeat 147..183 CDD:293791 13/35 (37%)
WD40 repeat 189..224 CDD:293791 6/19 (32%)
WD40 repeat 231..254 CDD:293791
WD40 repeat 273..297 CDD:293791
PAC1NP_014912.1 WD40 155..492 CDD:238121 58/253 (23%)
WD40 repeat 158..196 CDD:293791
WD40 repeat 202..251 CDD:293791 1/3 (33%)
WD40 repeat 256..294 CDD:293791 7/37 (19%)
WD40 repeat 301..339 CDD:293791 9/40 (23%)
WD40 repeat 346..414 CDD:293791 15/67 (22%)
WD40 repeat 420..458 CDD:293791 13/39 (33%)
WD40 repeat 465..492 CDD:293791 6/30 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.