DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Poc1 and CG7568

DIOPT Version :9

Sequence 1:NP_001261799.1 Gene:Poc1 / 39502 FlyBaseID:FBgn0036354 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001263071.1 Gene:CG7568 / 43482 FlyBaseID:FBgn0039673 Length:482 Species:Drosophila melanogaster


Alignment Length:294 Identity:71/294 - (24%)
Similarity:121/294 - (41%) Gaps:45/294 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FTGHSGGITQLRFGP-DGAQIATSSTDSTVILWNLNQAARCIRFASHSAPVNGVAWSPKGNLVAS 77
            |.||:..:....|.| ||..|||:|.|.:..::::..:....:...|.|.|....::..|.::.:
  Fly   220 FYGHTAELVAAEFHPVDGKSIATASLDGSARIYDVETSHELQQLTHHGAEVIAARFNRDGQMLLT 284

  Fly    78 AGHDRTVKIWEPKLRGVSGEFVAHSKAVRSVDFDSTGHLMLTASDDKSAKIWRVAR-RQFVSSFA 141
            ...|.:..||:.:.:.:..:...||..:.:..::.:|.|:.|.|.|.:|:||...: .|.:...|
  Fly   285 GSFDHSAAIWDVRSKSLGHQLRGHSAELSNCVWNFSGSLIATGSLDNTARIWDTRKLDQELYLAA 349

  Fly   142 QQNNWVRSAKFSPNGKLVATASDDKSVRIYDVDSGECVRTFTEERAAPRQLAWHPWGNMLAVALG 206
            :.::.|....|...|:|:||.|.|.:.|::.::..                              
  Fly   350 RHSDEVLDVSFDAAGQLLATCSSDCTARVWRLEGS------------------------------ 384

  Fly   207 CNRIKIFDVSGSQLLQLYVVHSAPVNDVAFHPSGHFLLSGSDDRTIRILDLLEGRPIYTLTGHTD 271
                     |..::|.|...||..|:.|.|.|||..||:.|.|.|.|:.....|:....|.||..
  Fly   385 ---------SELEMLSLMAGHSDEVSKVCFSPSGCMLLTASADNTARLWLTESGQCSQVLAGHEG 440

  Fly   272 AVNAVAFSRDGDKFATGGSDRQLLVWQSNLHTYD 305
            .|.:.|:|..||...|...|.....|:     ||
  Fly   441 EVFSCAYSYAGDAILTASKDNSCRFWR----XYD 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Poc1NP_001261799.1 WD40 10..298 CDD:238121 68/285 (24%)
WD40 14..388 CDD:225201 71/294 (24%)
WD40 repeat 22..58 CDD:293791 9/36 (25%)
WD40 repeat 63..99 CDD:293791 5/35 (14%)
WD40 repeat 106..140 CDD:293791 9/34 (26%)
WD40 repeat 147..183 CDD:293791 9/35 (26%)
WD40 repeat 189..224 CDD:293791 2/34 (6%)
WD40 repeat 231..254 CDD:293791 11/22 (50%)
WD40 repeat 273..297 CDD:293791 7/23 (30%)
CG7568NP_001263071.1 WD40 93..466 CDD:225201 68/284 (24%)
WD40 repeat 122..158 CDD:293791
WD40 154..467 CDD:238121 68/285 (24%)
WD40 repeat 189..222 CDD:293791 1/1 (100%)
WD40 repeat 228..265 CDD:293791 9/36 (25%)
WD40 repeat 270..306 CDD:293791 5/35 (14%)
WD40 repeat 314..348 CDD:293791 9/33 (27%)
WD40 repeat 355..393 CDD:293791 11/76 (14%)
WD40 repeat 400..436 CDD:293791 13/35 (37%)
WD40 repeat 442..466 CDD:293791 7/23 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442330
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.