DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Poc1 and CG10931

DIOPT Version :9

Sequence 1:NP_001261799.1 Gene:Poc1 / 39502 FlyBaseID:FBgn0036354 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_611261.1 Gene:CG10931 / 37024 FlyBaseID:FBgn0034274 Length:345 Species:Drosophila melanogaster


Alignment Length:304 Identity:79/304 - (25%)
Similarity:136/304 - (44%) Gaps:49/304 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ALERHFTGHSGGITQLRFGPDGAQIATSSTDSTVILWNLNQAARCIR-FASHSAPVNGVAWSPKG 72
            |::....||||.:|.|:|..:|..:.:||.|..:.||:|: |.|||: .|.|...||.||||..|
  Fly    47 AIKHSLLGHSGCVTGLKFSSNGENLVSSSGDRLLKLWDLS-ATRCIQSLAGHGDGVNDVAWSAAG 110

  Fly    73 NLVASAGHDRTVKIWEPKLRGVSGEFVAHSKAVRSVDFDSTGHLMLTASDDKSAKIWRVARRQFV 137
             |:||...|.||::|:.:.:........||:...|..|:...:|:.:.|.|::.::|.|...:.:
  Fly   111 -LIASCSDDMTVRLWDARSKLCVKVLEGHSRYSFSCCFNPQANLLASTSFDETVRLWDVRTGKTL 174

  Fly   138 SSFAQQNNWVRSAKFSPNGKLVATASDDKSVRIYDVDSGECVRTFTEERAAPRQLAWHPWGNMLA 202
            .......:.:.|..|..:|.:..|:|.|..||::|..:|..::|..:                  
  Fly   175 KIVHAHQDPITSVDFHRDGNIFVTSSYDGLVRLWDSSTGHVLKTLVD------------------ 221

  Fly   203 VALGCNRIKIFDVSGSQLLQLYVVHSAPVNDVAFHPSGHFLLSGSDDRTIRILDLLEGRPIYTLT 267
                                   |.:.||..|.|.|:|.::||.:.:.|:|:.:..:.:.:.|..
  Fly   222 -----------------------VDNIPVGYVKFSPNGRYILSSTLNNTLRLWNYKKPKCMRTYR 263

  Fly   268 GHTD---AVNAVAFSRDGDKFATGGSDRQLLVWQSNLHTYDASQ 308
            ||.:   ..|:...:..|....:|..|..|.:|  ||.|.:..|
  Fly   264 GHLNEFYCSNSNFSTTGGIWIVSGSEDNTLCIW--NLQTRELVQ 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Poc1NP_001261799.1 WD40 10..298 CDD:238121 73/291 (25%)
WD40 14..388 CDD:225201 78/299 (26%)
WD40 repeat 22..58 CDD:293791 14/36 (39%)
WD40 repeat 63..99 CDD:293791 14/35 (40%)
WD40 repeat 106..140 CDD:293791 7/33 (21%)
WD40 repeat 147..183 CDD:293791 11/35 (31%)
WD40 repeat 189..224 CDD:293791 0/34 (0%)
WD40 repeat 231..254 CDD:293791 8/22 (36%)
WD40 repeat 273..297 CDD:293791 5/23 (22%)
CG10931NP_611261.1 WD40 <48..341 CDD:225201 78/303 (26%)
WD40 49..341 CDD:238121 78/302 (26%)
WD40 repeat 59..96 CDD:293791 14/37 (38%)
WD40 repeat 102..137 CDD:293791 13/35 (37%)
WD40 repeat 142..178 CDD:293791 7/35 (20%)
WD40 repeat 185..220 CDD:293791 11/34 (32%)
WD40 repeat 227..263 CDD:293791 10/35 (29%)
WD40 repeat 271..309 CDD:293791 10/37 (27%)
WD40 repeat 314..340 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442345
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.