DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Poc1 and Lis-1

DIOPT Version :9

Sequence 1:NP_001261799.1 Gene:Poc1 / 39502 FlyBaseID:FBgn0036354 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001246361.1 Gene:Lis-1 / 36791 FlyBaseID:FBgn0015754 Length:411 Species:Drosophila melanogaster


Alignment Length:309 Identity:88/309 - (28%)
Similarity:143/309 - (46%) Gaps:29/309 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 TGHSGGITQLRFGPDGAQIATSSTDSTVILWNLNQAARCIRFASHSAPVNGVAWSPKGNLVASAG 79
            |||...||::.|.|..|.:.::|.|:|:.:|:............|:..|..||:..:|.|:||..
  Fly   105 TGHRASITRVIFHPIFALMVSASEDATIRIWDFETGEYERSLKGHTDSVQDVAFDAQGKLLASCS 169

  Fly    80 HDRTVKIWEPK-----LRGVSGEFVAHSKAVRSVDFDSTGHLMLTASDDKSAKIWRVARRQFVSS 139
            .|.::|:|:.:     ::.:.|    |...|.||.|...|..:|:||.|::.|:|.||....|.:
  Fly   170 ADLSIKLWDFQQSYECIKTMHG----HDHNVSSVAFVPAGDYVLSASRDRTIKMWEVATGYCVKT 230

  Fly   140 FAQQNNWVRSAKFSPNGKLVATASDDKSVRIYDVDSGECVRTFTEERAAPRQLAW---------- 194
            :.....|||..:....|.:.||.|:|:::|::..:|.:|.....:.......:||          
  Fly   231 YTGHREWVRMVRVHIEGSIFATCSNDQTIRVWLTNSKDCKVELRDHEHTVECIAWAPEAAASAIN 295

  Fly   195 ----------HPWGNMLAVALGCNRIKIFDVSGSQLLQLYVVHSAPVNDVAFHPSGHFLLSGSDD 249
                      |..|..||.......|:|:|||....|.....|...|..:||||.|.:|:|.|||
  Fly   296 EAAGADNKKGHHQGPFLASGSRDKTIRIWDVSVGLCLLTLSGHDNWVRGLAFHPGGKYLVSASDD 360

  Fly   250 RTIRILDLLEGRPIYTLTGHTDAVNAVAFSRDGDKFATGGSDRQLLVWQ 298
            :|||:.||...|.:.||..|.....::.|.:......:|..|:.:.||:
  Fly   361 KTIRVWDLRNKRCMKTLYAHQHFCTSIDFHKAHPYVISGSVDQTVKVWE 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Poc1NP_001261799.1 WD40 10..298 CDD:238121 87/307 (28%)
WD40 14..388 CDD:225201 88/309 (28%)
WD40 repeat 22..58 CDD:293791 8/35 (23%)
WD40 repeat 63..99 CDD:293791 11/40 (28%)
WD40 repeat 106..140 CDD:293791 13/33 (39%)
WD40 repeat 147..183 CDD:293791 10/35 (29%)
WD40 repeat 189..224 CDD:293791 12/54 (22%)
WD40 repeat 231..254 CDD:293791 13/22 (59%)
WD40 repeat 273..297 CDD:293791 3/23 (13%)
Lis-1NP_001246361.1 LisH 9..40 CDD:128913
WD40 100..409 CDD:238121 87/307 (28%)
WD40 repeat 111..148 CDD:293791 9/36 (25%)
WD40 repeat 154..191 CDD:293791 9/36 (25%)
WD40 repeat 196..232 CDD:293791 14/35 (40%)
WD40 repeat 239..274 CDD:293791 9/34 (26%)
WD40 repeat 280..336 CDD:293791 12/55 (22%)
WD40 repeat 342..378 CDD:293791 18/35 (51%)
WD40 repeat 384..408 CDD:293791 3/23 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442347
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.