DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Poc1 and Wdr5

DIOPT Version :9

Sequence 1:NP_001261799.1 Gene:Poc1 / 39502 FlyBaseID:FBgn0036354 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001034123.1 Gene:Wdr5 / 362093 RGDID:1305159 Length:334 Species:Rattus norvegicus


Alignment Length:302 Identity:82/302 - (27%)
Similarity:153/302 - (50%) Gaps:14/302 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ALERHFTGHSGGITQLRFGPDGAQIATSSTDSTVILWNLNQAARCIRFASHSAPVNGVAWSPKGN 73
            ||:....||:..::.::|.|:|..:|:||.|..:.:|...........:.|...::.||||...|
  Rat    36 ALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSN 100

  Fly    74 LVASAGHDRTVKIWEPK----LRGVSGEFVAHSKAVRSVDFDSTGHLMLTASDDKSAKIWRVARR 134
            |:.||..|:|:|||:..    |:.:.|    ||..|...:|:...:|:::.|.|:|.:||.|...
  Rat   101 LLVSASDDKTLKIWDVSSGKCLKTLKG----HSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTG 161

  Fly   135 QFVSSFAQQNNWVRSAKFSPNGKLVATASDDKSVRIYDVDSGECVRTFTEERAAPRQ-LAWHPWG 198
            :.:.:....::.|.:..|:.:|.|:.::|.|...||:|..||:|::|..::...|.. :.:.|.|
  Rat   162 KCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNG 226

  Fly   199 NMLAVALGCNRIKIFDVSGSQLLQLYVVHSAPVNDVAFHPS---GHFLLSGSDDRTIRILDLLEG 260
            ..:..|...|.:|::|.|..:.|:.|..|......:..:.|   |.:::|||:|..:.|.:|...
  Rat   227 KYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTK 291

  Fly   261 RPIYTLTGHTDAVNAVAFSRDGDKFATGG--SDRQLLVWQSN 300
            ..:..|.||||.|.:.|.....:..|:..  :|:.:.:|:|:
  Rat   292 EIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSD 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Poc1NP_001261799.1 WD40 10..298 CDD:238121 79/297 (27%)
WD40 14..388 CDD:225201 80/297 (27%)
WD40 repeat 22..58 CDD:293791 8/35 (23%)
WD40 repeat 63..99 CDD:293791 15/39 (38%)
WD40 repeat 106..140 CDD:293791 8/33 (24%)
WD40 repeat 147..183 CDD:293791 13/35 (37%)
WD40 repeat 189..224 CDD:293791 9/35 (26%)
WD40 repeat 231..254 CDD:293791 6/25 (24%)
WD40 repeat 273..297 CDD:293791 4/25 (16%)
Wdr5NP_001034123.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
WD40 37..331 CDD:238121 79/297 (27%)
WD 1 43..82 10/38 (26%)
WD40 repeat 48..85 CDD:293791 8/36 (22%)
WD 2 85..126 15/40 (38%)
WD40 repeat 91..127 CDD:293791 14/35 (40%)
WD 3 128..168 11/39 (28%)
WD40 repeat 132..168 CDD:293791 9/35 (26%)
WD 4 169..208 12/38 (32%)
WD40 repeat 175..210 CDD:293791 12/34 (35%)
WD 5 212..253 9/40 (23%)
WD40 repeat 217..253 CDD:293791 8/35 (23%)
WD 6 256..296 8/39 (21%)
WD40 repeat 261..298 CDD:293791 8/36 (22%)
WD 7 299..333 9/33 (27%)
WD40 repeat 304..330 CDD:293791 4/25 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53955
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.