DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Poc1 and wdr-5.1

DIOPT Version :9

Sequence 1:NP_001261799.1 Gene:Poc1 / 39502 FlyBaseID:FBgn0036354 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_497749.1 Gene:wdr-5.1 / 175474 WormBaseID:WBGene00006474 Length:376 Species:Caenorhabditis elegans


Alignment Length:297 Identity:80/297 - (26%)
Similarity:137/297 - (46%) Gaps:48/297 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GHSGGITQLRFGPDGAQIATSSTDSTVILWNLNQAARCIR-FASHSAPVNGVAWSPKGNLVASAG 79
            ||:..|:..:|.|.|..:.|||.|.||.:||::... |.| ...|...||.:|||.....|.||.
 Worm    85 GHTKSISSAKFSPCGKYLGTSSADKTVKIWNMDHMI-CERTLTGHKLGVNDIAWSSDSRCVVSAS 148

  Fly    80 HDRTVKIWEPKLRGVSGEFVAHSKAVRSVDFDSTGHLMLTASDDKSAKIWRVARRQFVSSFAQQN 144
            .|:|:||:|.....::.....|:..|...:|:....|:::.|.|:|.:||.|.....:.:....:
 Worm   149 DDKTLKIFEIVTSRMTKTLKGHNNYVFCCNFNPQSSLVVSGSFDESVRIWDVKTGMCIKTLPAHS 213

  Fly   145 NWVRSAKFSPNGKLVATASDDKSVRIYDVDSGECVRTFTEERAAPRQLAWHPWGNMLAVALGCNR 209
            :.|.:..|:.:|.|:|:.|.|..|||:|..:|:|::|..::                        
 Worm   214 DPVSAVSFNRDGSLIASGSYDGLVRIWDTANGQCIKTLVDD------------------------ 254

  Fly   210 IKIFDVSGSQLLQLYVVHSAPVNDVAFHPSGHFLLSGSDDRTIRILDLLEGRPIYTLTGHTDAVN 274
                             .:.||..|.|.|:|.::|:.:.|.|:::.|..:|:.:...|||.::..
 Worm   255 -----------------ENPPVAFVKFSPNGKYILASNLDSTLKLWDFSKGKTLKQYTGHENSKY 302

  Fly   275 AV--AFSRDGDKFATGGS-DRQLLVWQSNLHTYDASQ 308
            .:  .||..|.|:...|| |.::.:|  ||.|.:..|
 Worm   303 CIFANFSVTGGKWIISGSEDCKIYIW--NLQTREIVQ 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Poc1NP_001261799.1 WD40 10..298 CDD:238121 75/285 (26%)
WD40 14..388 CDD:225201 80/297 (27%)
WD40 repeat 22..58 CDD:293791 13/36 (36%)
WD40 repeat 63..99 CDD:293791 13/35 (37%)
WD40 repeat 106..140 CDD:293791 8/33 (24%)
WD40 repeat 147..183 CDD:293791 14/35 (40%)
WD40 repeat 189..224 CDD:293791 0/34 (0%)
WD40 repeat 231..254 CDD:293791 8/22 (36%)
WD40 repeat 273..297 CDD:293791 7/26 (27%)
wdr-5.1NP_497749.1 WD40 <76..372 CDD:225201 80/297 (27%)
WD40 79..373 CDD:238121 80/297 (27%)
WD40 repeat 90..127 CDD:293791 14/37 (38%)
WD40 repeat 133..169 CDD:293791 12/35 (34%)
WD40 repeat 174..210 CDD:293791 9/35 (26%)
WD40 repeat 217..252 CDD:293791 13/34 (38%)
WD40 repeat 259..295 CDD:293791 10/35 (29%)
WD40 repeat 303..340 CDD:293791 12/37 (32%)
WD40 repeat 346..372 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157519
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53955
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.