DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10171 and AT1G78620

DIOPT Version :9

Sequence 1:NP_729888.1 Gene:CG10171 / 39501 FlyBaseID:FBgn0036353 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_974171.1 Gene:AT1G78620 / 844198 AraportID:AT1G78620 Length:342 Species:Arabidopsis thaliana


Alignment Length:270 Identity:66/270 - (24%)
Similarity:114/270 - (42%) Gaps:57/270 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 AALGILVAFILS--------------IASHPFFASLVVFFFSSSRATKFRAHMKRRFESDFREGE 125
            :|.||..||:|.              :|::....|..|...:.:.|||.:...|.. :....:.:
plant   109 SASGIAAAFLLGTLTWRAYGSAGFLLVAAYFVIVSAFVINLNGTAATKVKMTQKEA-QGVAEKRK 172

  Fly   126 GQRNWIQVLCNGGMAAQLALLYLLDCGSGERAVDFAREYRSSWLGVAVMSAFACCNGDTWSSELG 190
            |:|....|:.:.......|.|.:...|...    |::.:|     :..:|:|.....||.|||:|
plant   173 GRRGPRSVIGSSAAGCVCAFLSIYQVGGAA----FSQLFR-----LGFVSSFCTKVSDTVSSEIG 228

  Fly   191 SVLSQRDPVSIITWRRVPRGTNGGVSLLGVAVSLLGGLLVGFGYFVTVRYTVEAKMLLISPPQWP 255
            ....:...:: .|::.|||||.|.:||.|.    |.|||..|  |:.   :|...:..|:||:..
plant   229 KAYGKTTYLA-TTFKIVPRGTEGAMSLEGT----LAGLLASF--FLA---SVGCFLGQITPPEAA 283

  Fly   256 IIAFGGIAGLFGSLLDSVLGGLLQFSGINEEGKIVDTPGKGVRHVSGLRILDNHSVNLISSIVTG 320
            :..   :|....:|.:|::|...|    ::|               |.:.|:|..||:| :|..|
plant   284 VCV---LASQIANLGESIIGASFQ----DKE---------------GFKWLNNDVVNVI-NISLG 325

  Fly   321 VTIPLLAQRF 330
            ..:.:|.|:|
plant   326 SIVAILMQQF 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10171NP_729888.1 DUF92 59..318 CDD:280173 61/256 (24%)
AT1G78620NP_974171.1 DUF92 108..324 CDD:280173 62/257 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1836
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102547
Panther 1 1.100 - - O PTHR13353
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.