DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARHGAP6 and RacGAP84C

DIOPT Version :9

Sequence 1:NP_038286.2 Gene:ARHGAP6 / 395 HGNCID:676 Length:974 Species:Homo sapiens
Sequence 2:NP_476704.1 Gene:RacGAP84C / 117503 FlyBaseID:FBgn0045843 Length:384 Species:Drosophila melanogaster


Alignment Length:260 Identity:60/260 - (23%)
Similarity:102/260 - (39%) Gaps:66/260 - (25%)


- Green bases have known domain annotations that are detailed below.


Human   410 VPRLVDSCCQHLEKHGLQTVGIFRVGSSKKRVRQLREEFDRGIDVSLEEEHSVHDVAALLKEFLR 474
            ||.|:..|...:|..|||..|::||.|::::.::||.:..||...........|.:...:|:|||
  Fly   160 VPALIVHCVTEIEARGLQQEGLYRVSSTREKCKRLRRKLLRGKSTPHLGNKDTHTLCCCVKDFLR 224

Human   475 DMPDPLL----TRELYTAFINTLLLEPEEQLGTLQLLIYL----LPPCNCDTLHRLLQFLSIVAR 531
            .:..||:    .|:...|      ...|::| .:::.:||    |...:.|||..|:.....:| 
  Fly   225 QLVHPLIPIYHRRDFEEA------TRHEDRL-AVEMAVYLAVLELHQAHRDTLAYLMLHWQKIA- 281

Human   532 HADDNISKDGQEVTGNKMTSLNLATIFGPNLLHKQKSSDKEFSVQSSARAEESTAIIAVVQKMIE 596
                       |....:||..|||.||.|.|.     .|.:.::::          :...|::: 
  Fly   282 -----------ESPAVRMTVNNLAVIFAPTLF-----GDLDLTLEN----------VVTWQRVL- 319

Human   597 NYEALFMVPPDLQNEVLISLLETDPDVVDYLLRRKASQSSSPDMLQSEVSFS--VGGRHSSTDSN 659
              :.|.::|....::    .||..|               .|..|.|...|.  ...||..:.||
  Fly   320 --KVLLLMPAGFW
SQ----FLEVHP---------------LPTSLGSTYDFEDRYNHRHWDSSSN 363

Human   660  659
              Fly   364  363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARHGAP6NP_038286.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..120
PBP_N 67..>121 CDD:293698
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 322..361
SH3-binding 342..352
RhoGAP_ARHGAP6 402..608 CDD:239841 49/205 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 639..672 7/23 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 709..729
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 742..838
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 860..945
RacGAP84CNP_476704.1 C1_1 87..139 CDD:278556
RhoGAP_MgcRacGAP 142..330 CDD:239847 49/206 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.