DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNCF and CG13713

DIOPT Version :10

Sequence 1:NP_648635.1 Gene:SNCF / 39496 FlyBaseID:FBgn0036349 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_652709.1 Gene:CG13713 / 59233 FlyBaseID:FBgn0042199 Length:99 Species:Drosophila melanogaster


Alignment Length:85 Identity:32/85 - (37%)
Similarity:54/85 - (63%) Gaps:7/85 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 KKLRRKSATVNFPYQLFLYRQELRRASADFSYLRLSKAKIVLTSQLIAKKMGSCNPDCSVDELKE 108
            :|:.:.:.|    |.|||||.||.|.:|  ..||||:.||.:|.:||:..:.:.. .||:|:||.
  Fly     4 EKMLKPTVT----YHLFLYRVELARRNA--RQLRLSRTKIEITDELISNTVRNLK-TCSLDDLKA 61

  Fly   109 LSREVQFQKRLCHQVERLQQ 128
            ::||:.|:::|...|.:|::
  Fly    62 VNRELLFKRKLRSNVSKLKK 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNCFNP_648635.1 DUF733 52..137 CDD:428418 31/77 (40%)
CG13713NP_652709.1 DUF733 8..92 CDD:428418 31/81 (38%)

Return to query results.
Submit another query.