DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caps and lrrn3

DIOPT Version :9

Sequence 1:NP_001303391.1 Gene:caps / 39493 FlyBaseID:FBgn0023095 Length:811 Species:Drosophila melanogaster
Sequence 2:NP_001072526.1 Gene:lrrn3 / 779981 XenbaseID:XB-GENE-490955 Length:706 Species:Xenopus tropicalis


Alignment Length:393 Identity:105/393 - (26%)
Similarity:175/393 - (44%) Gaps:49/393 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LGLA------------NCPNGCECD-----------DDTLMVNCGEGTLDVLPIALNPAIQRLVI 79
            ||||            :||:.|.|:           .:.|.|:|....|..:|..|....|.|::
 Frog    12 LGLAIATHGHTTPKKMDCPHSCSCEIRPWFTPKSIYIEALTVDCNALDLYSVPDKLPAKTQILLL 76

  Fly    80 KNNKLKTIDSSMQFYAQLTFLDLSFNDMLTIPERSFAYHAKLQELHLDHNKIGQVSNKTFLGLST 144
            :.|.::.|.::..|...||.||||.|::..|...:|....::..::|:.||:.::...:|.||. 
 Frog    77 QANNIEEIKNTDHFPVNLTGLDLSQNNLSLIANINFTNMHQILSVYLEENKLTELMEGSFSGLE- 140

  Fly   145 ISVLNLRGNLIAELEYRTFSPMVKLAELNLGQNRISHIDPHALDGLDNLRVLYLDDNTLTTVPGE 209
                                   .|.||.:..|.||.|.|.|..|:.||..|:|:.|.|..: ..
 Frog   141 -----------------------NLQELYINHNLISVISPKAFAGVSNLLRLHLNSNRLQMI-NS 181

  Fly   210 LTFQALHSLAELYLGTNSFMTIPGGAFQDLKGLTRLDLRGAGLHNISGDALKGLVSLRFLDLSDN 274
            :.|:|:.:|..|.:|.|..:.|....|:.|..|..|.|.|..|..|..:|..||..|..:...||
 Frog   182 MWFEAIPNLEILMIGENPIVNIEDMNFKPLINLRSLVLAGVNLTEIPDNAFLGLDKLESISFYDN 246

  Fly   275 RLPAIPTAAFQRLGRLEQLNIGQNDFEVISSGAFSGLRELRHLELTGAQRLRRVESGAFSGNTNL 339
            :...:|:.|.|::..|:.|::.:|....|..|.||.:..|:.|.:.....|..::|.|......|
 Frog   247 KFIHVPSVALQKVVNLKFLDLNKNPVRRIQRGDFSNMLHLKELGINNMPELVSIDSLAIENLPEL 311

  Fly   340 EHLNLSSNKQLNELSSIALGGLPHLSTVVLKANQLSSLDEGLV-PWADLQTLDLSENPFECDCRL 403
            ..:..::|.:|..:...|...||.|.|::|.:|.||::....: ...:|:.:.:..||..|||.:
 Frog   312 RKIEATNNPKLAYIHPNAFYRLPKLETLMLNSNSLSAIYRSTIEALPNLKEISIHSNPMRCDCVI 376

  Fly   404 LWL 406
            .|:
 Frog   377 RWI 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
capsNP_001303391.1 leucine-rich repeat 75..96 CDD:275380 5/20 (25%)
LRR_8 96..155 CDD:290566 15/58 (26%)
leucine-rich repeat 97..120 CDD:275380 9/22 (41%)
leucine-rich repeat 121..144 CDD:275380 6/22 (27%)
LRR_8 143..201 CDD:290566 14/57 (25%)
leucine-rich repeat 145..168 CDD:275380 0/22 (0%)
LRR_RI 147..397 CDD:238064 66/250 (26%)
leucine-rich repeat 169..192 CDD:275380 10/22 (45%)
leucine-rich repeat 193..217 CDD:275380 7/23 (30%)
LRR_8 217..276 CDD:290566 19/58 (33%)
leucine-rich repeat 218..241 CDD:275380 7/22 (32%)
leucine-rich repeat 242..265 CDD:275380 9/22 (41%)
LRR_8 265..321 CDD:290566 15/55 (27%)
leucine-rich repeat 266..289 CDD:275380 6/22 (27%)
leucine-rich repeat 290..313 CDD:275380 7/22 (32%)
LRR_8 312..374 CDD:290566 15/61 (25%)
leucine-rich repeat 314..335 CDD:275380 5/20 (25%)
leucine-rich repeat 339..363 CDD:275380 5/23 (22%)
LRRCT 395..445 CDD:214507 6/12 (50%)
lrrn3NP_001072526.1 leucine-rich repeat 52..70 CDD:275380 5/17 (29%)
leucine-rich repeat 71..93 CDD:275380 5/21 (24%)
leucine-rich repeat 94..117 CDD:275380 9/22 (41%)
leucine-rich repeat 118..141 CDD:275380 6/46 (13%)
LRR_8 120..176 CDD:290566 21/79 (27%)
leucine-rich repeat 142..165 CDD:275380 10/22 (45%)
LRR_8 164..221 CDD:290566 18/57 (32%)
leucine-rich repeat 166..189 CDD:275380 7/23 (30%)
leucine-rich repeat 190..213 CDD:275380 7/22 (32%)
LRR_8 213..272 CDD:290566 18/58 (31%)
leucine-rich repeat 214..237 CDD:275380 9/22 (41%)
leucine-rich repeat 238..261 CDD:275380 6/22 (27%)
leucine-rich repeat 262..285 CDD:275380 7/22 (32%)
leucine-rich repeat 286..310 CDD:275380 5/23 (22%)
LRR_8 309..370 CDD:290566 14/60 (23%)
leucine-rich repeat 311..333 CDD:275380 4/21 (19%)
leucine-rich repeat 336..359 CDD:275378 6/22 (27%)
leucine-rich repeat 360..372 CDD:275378 3/11 (27%)
TPKR_C2 368..419 CDD:301599 6/12 (50%)
I-set 429..513 CDD:254352
IGc2 437..503 CDD:197706
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11458
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I4049
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm14097
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.