DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caps and LRRC4

DIOPT Version :9

Sequence 1:NP_001303391.1 Gene:caps / 39493 FlyBaseID:FBgn0023095 Length:811 Species:Drosophila melanogaster
Sequence 2:NP_071426.1 Gene:LRRC4 / 64101 HGNCID:15586 Length:653 Species:Homo sapiens


Alignment Length:779 Identity:178/779 - (22%)
Similarity:254/779 - (32%) Gaps:274/779 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LCLVLATLPVALGLANCPNGCECDDDTLMVNCGEGTLDVLPIALNPAIQRLVIKNNKLKTIDSSM 91
            ||..:|....| |..|||:.|.|.:....|.|....|..:|                 :.|.|:.
Human    31 LCAAIAAAASA-GPQNCPSVCSCSNQFSKVVCTRRGLSEVP-----------------QGIPSNT 77

  Fly    92 QFYAQLTFLDLSFNDMLTIPERSFAYHAKLQELHLDHNKIGQVSNKTFLGLSTISVLNLRGNLIA 156
            ::                                                      |||..|.|.
Human    78 RY------------------------------------------------------LNLMENNIQ 88

  Fly   157 ELEYRTFSPMVKLAELNLGQNRISHIDPHALDGLDNLRVLYLDDNTLTTVPGELTFQALHSLAEL 221
            .::..||..:..|..|.||:|.|..|:..|.:||.:|..|.|.||.||.:|.. .|:.|..|.||
Human    89 MIQADTFRHLHHLEVLQLGRNSIRQIEVGAFNGLASLNTLELFDNWLTVIPSG-AFEYLSKLREL 152

  Fly   222 YLGTNSFMTIPGGAFQDLKGLTRLDLRGAG----LHNISGDALKGLVSLRFLDLSDNRLPAIPTA 282
            :|..|...:||..||..:..|.||||   |    |..||..|.:||.:|::|:|....:..:|. 
Human   153 WLRNNPIESIPSYAFNRVPSLMRLDL---GELKKLEYISEGAFEGLFNLKYLNLGMCNIKDMPN- 213

  Fly   283 AFQRLGRLEQLNIGQNDFEVISSGAFSGLRELRHLELTGAQRLRRVESGAFSGNTNLEHLNLSSN 347
             ...|..||:|.:..|.|..|..|:|.||..|:.|.:..:| :..:|..||.|..:|..|||:.|
Human   214 -LTPLVGLEELEMSGNHFPEIRPGSFHGLSSLKKLWVMNSQ-VSLIERNAFDGLASLVELNLAHN 276

  Fly   348 KQLNELSSIALGGLPHLSTVVLKANQLSSLDEGLVPWADLQTLDLSENPFECDCRLLWL------ 406
            .         |..|||               :...|...|..|.|..||:.|||.:|||      
Human   277 N---------LSSLPH---------------DLFTPLRYLVELHLHHNPWNCDCDILWLAWWLRE 317

  Fly   407 --------------------RHLLVSRNASGQ-YAPVICAYPTALRDLPLA--HLAEPLLGCAHG 448
                                |:|:....||.| .||.|...|   |||.::  .:||  |.|...
Human   318 YIPTNSTCCGRCHAPMHMRGRYLVEVDQASFQCSAPFIMDAP---RDLNISEGRMAE--LKCRTP 377

  Fly   449 AASKQAIIGILVVACAALITTLALVLYTCRH-RIREMLKG-----HSALGRKEREYQKTFSDEEY 507
            ..|          :...|:....::.:..|| ||..:..|     |..|           ||.  
Human   378 PMS----------SVKWLLPNGTVLSHASRHPRISVLNDGTLNFSHVLL-----------SDT-- 419

  Fly   508 MSRPPPGGGGVHPAAGGYPYIAGNSR-----------------------MIPVTELXLE------ 543
                     ||:...  ...:||||.                       .:..||: .|      
Human   420 ---------GVYTCM--VTNVAGNSNASAYLNVSTAELNTSNYSFFTTVTVETTEISPEDTTRKY 473

  Fly   544 APPPPQLRGRGGGGGASTASGAVQQLQVPSAVDQASNSFAQLSHIHYMTNNGQQQQAQQQQSTSK 608
            .|.|....|.......|| :..:|..:||..|...:..          |.:..|....:...|:|
Human   474 KPVPTTSTGYQPAYTTST-TVLIQTTRVPKQVAVPATD----------TTDKMQTSLDEVMKTTK 527

  Fly   609 MHHSQQDMRLLACNGGKPLNATSL--------PRHRPPVVQESTLS----------HYSQPLANG 655
            :        ::.|.....|.|.::        .||:    |.||::          ....|.|..
Human   528 I--------IIGCFVAVTLLAAAMLIVFYKLRKRHQ----QRSTVTAARTVEIIQVDEDIPAATS 580

  Fly   656 IRLT-----------------QDHFNHN-QNQSHNQHY-----GGVYAKPCDAMSEPGYIHNNS 696
            ...|                 .||.|:| ...:|..|:     |.........:|||..|..::
Human   581 AAATAAPSGVSGEGAVVLPTIHDHINYNTYKPAHGAHWTENSLGNSLHPTVTTISEPYIIQTHT 644

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
capsNP_001303391.1 leucine-rich repeat 75..96 CDD:275380 2/20 (10%)
LRR_8 96..155 CDD:290566 4/58 (7%)
leucine-rich repeat 97..120 CDD:275380 0/22 (0%)
leucine-rich repeat 121..144 CDD:275380 0/22 (0%)
LRR_8 143..201 CDD:290566 20/57 (35%)
leucine-rich repeat 145..168 CDD:275380 7/22 (32%)
LRR_RI 147..397 CDD:238064 84/253 (33%)
leucine-rich repeat 169..192 CDD:275380 10/22 (45%)
leucine-rich repeat 193..217 CDD:275380 10/23 (43%)
LRR_8 217..276 CDD:290566 24/62 (39%)
leucine-rich repeat 218..241 CDD:275380 9/22 (41%)
leucine-rich repeat 242..265 CDD:275380 12/26 (46%)
LRR_8 265..321 CDD:290566 17/55 (31%)
leucine-rich repeat 266..289 CDD:275380 5/22 (23%)
leucine-rich repeat 290..313 CDD:275380 10/22 (45%)
LRR_8 312..374 CDD:290566 16/61 (26%)
leucine-rich repeat 314..335 CDD:275380 6/20 (30%)
leucine-rich repeat 339..363 CDD:275380 7/23 (30%)
LRRCT 395..445 CDD:214507 23/78 (29%)
LRRC4NP_071426.1 LRRNT 46..79 CDD:214470 10/49 (20%)
LRR <74..291 CDD:227223 81/301 (27%)
LRR 1 76..97 7/74 (9%)
leucine-rich repeat 77..100 CDD:275380 7/76 (9%)
LRR 2 100..121 8/20 (40%)
leucine-rich repeat 101..124 CDD:275380 10/22 (45%)
LRR 3 124..145 9/21 (43%)
leucine-rich repeat 125..148 CDD:275380 10/23 (43%)
LRR 4 148..169 9/20 (45%)
leucine-rich repeat 149..172 CDD:275380 9/22 (41%)
LRR 5 172..194 10/24 (42%)
leucine-rich repeat 173..197 CDD:275380 12/26 (46%)
LRR 6 197..218 4/22 (18%)
leucine-rich repeat 198..219 CDD:275380 5/22 (23%)
LRR 7 219..240 8/20 (40%)
leucine-rich repeat 220..243 CDD:275380 10/22 (45%)
LRR 8 243..264 6/21 (29%)
leucine-rich repeat 244..267 CDD:275380 7/23 (30%)
LRR 9 267..288 9/44 (20%)
leucine-rich repeat 268..289 CDD:275380 9/44 (20%)
LRRCT 300..351 CDD:214507 13/50 (26%)
IG 359..441 CDD:214652 25/120 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I4370
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.