DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caps and CG42709

DIOPT Version :9

Sequence 1:NP_001303391.1 Gene:caps / 39493 FlyBaseID:FBgn0023095 Length:811 Species:Drosophila melanogaster
Sequence 2:NP_001163434.1 Gene:CG42709 / 39453 FlyBaseID:FBgn0261674 Length:458 Species:Drosophila melanogaster


Alignment Length:339 Identity:85/339 - (25%)
Similarity:124/339 - (36%) Gaps:99/339 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 HLGQAFSLCLCLCLCLVLATLPVALGLAN-CPNGCE----------CDDDTLMVNCGEGTLDVLP 67
            |:...|.|       |::..|.|::...| .|.|.|          .|||......||.:.:.  
  Fly     2 HVYYKFGL-------LLIFLLSVSISHTNAAPAGSEEANPLEDFNYGDDDYSETATGEESPET-- 57

  Fly    68 IALNPAIQRLVIKNNKLKTIDSSMQFYAQLTFLDLSFNDMLTIPERS-----------------F 115
                        ..|:|....||       |....:|..:..||.||                 |
  Fly    58 ------------AENRLMPQSSS-------TSTTTTFRPIFNIPRRSNHVLEPSCPRNCLCLEDF 103

  Fly   116 AY----HAKLQELHLDHNKIGQVSNKTFLGLSTISVLNLRGNLIAELEYRTFSPMVKLAELNLGQ 176
            .:    :|.|..:.||..|             |.::::|..|:||||....|:.:.:..|:||..
  Fly   104 KFVQCANAHLTHVPLDMPK-------------TAAIIDLSHNVIAELRPEDFANLSRAVEINLNH 155

  Fly   177 NRISHIDPHALDGLDNLRVLYLDDNTLTTVPGELTFQALHSLAELYLGTNSFMTIPGGAFQDLKG 241
            |.||.||.....|.:.|:.|.|.:|.||.:..: ||.|...|..|.|..|:......|:|     
  Fly   156 NLISSIDKDVFQGSERLKRLRLANNRLTKIDPD-TFAAAKELTLLDLSNNTITQRLDGSF----- 214

  Fly   242 LTRLDLRGAGLHNISGDALKGLVSLRFLDLSDNRLPAIPTAAFQRLGRLEQLNIGQNDF-EVISS 305
            |.:.||......|.|...|                   |...||.:..||.|.:.:||| :.|::
  Fly   215 LNQPDLVEFSCVNCSWTEL-------------------PEQTFQNMSGLEVLRLNKNDFKQQINT 260

  Fly   306 GAFSGLRELRHLEL 319
            .|||.|.::..|:|
  Fly   261 KAFSPLTKIIKLKL 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
capsNP_001303391.1 leucine-rich repeat 75..96 CDD:275380 4/20 (20%)
LRR_8 96..155 CDD:290566 15/79 (19%)
leucine-rich repeat 97..120 CDD:275380 7/43 (16%)
leucine-rich repeat 121..144 CDD:275380 4/22 (18%)
LRR_8 143..201 CDD:290566 20/57 (35%)
leucine-rich repeat 145..168 CDD:275380 7/22 (32%)
LRR_RI 147..397 CDD:238064 53/174 (30%)
leucine-rich repeat 169..192 CDD:275380 9/22 (41%)
leucine-rich repeat 193..217 CDD:275380 9/23 (39%)
LRR_8 217..276 CDD:290566 12/58 (21%)
leucine-rich repeat 218..241 CDD:275380 6/22 (27%)
leucine-rich repeat 242..265 CDD:275380 6/22 (27%)
LRR_8 265..321 CDD:290566 16/56 (29%)
leucine-rich repeat 266..289 CDD:275380 3/22 (14%)
leucine-rich repeat 290..313 CDD:275380 11/23 (48%)
LRR_8 312..374 CDD:290566 2/8 (25%)
leucine-rich repeat 314..335 CDD:275380 2/6 (33%)
leucine-rich repeat 339..363 CDD:275380
LRRCT 395..445 CDD:214507
CG42709NP_001163434.1 LRR_8 126..182 CDD:290566 20/55 (36%)
leucine-rich repeat 128..147 CDD:275380 7/18 (39%)
leucine-rich repeat 148..171 CDD:275380 9/22 (41%)
LRR_RI <150..225 CDD:238064 27/80 (34%)
LRR_8 171..254 CDD:290566 28/107 (26%)
leucine-rich repeat 172..195 CDD:275380 9/23 (39%)
leucine-rich repeat 196..219 CDD:275380 7/27 (26%)
leucine-rich repeat 220..243 CDD:275380 7/41 (17%)
leucine-rich repeat 244..268 CDD:275380 11/23 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453538
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.