DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caps and CG6749

DIOPT Version :9

Sequence 1:NP_001303391.1 Gene:caps / 39493 FlyBaseID:FBgn0023095 Length:811 Species:Drosophila melanogaster
Sequence 2:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster


Alignment Length:478 Identity:115/478 - (24%)
Similarity:194/478 - (40%) Gaps:121/478 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 APHLGQAFSLCLCLCLCLVLATLPVAL---GLANCPN-------GCECDDDTLMVNCGEGTLDVL 66
            |.||.....|.|       ....|:.:   |.:..||       ||             |.:|:.
  Fly    76 ADHLANLLDLDL-------TGAAPINVHTNGFSILPNLRQLNLSGC-------------GLVDIR 120

  Fly    67 --PIALNPAIQRLVIKNNKLKTIDSSMQFYA---QLTFLDLSFN-----DMLTIP---------- 111
              ..|...|:||:...:|:::.:|  ..|:.   :|.:.:.|.|     |:..:|          
  Fly   121 GNHFAPESALQRIDFSHNQMELLD--RDFFGNLRKLIYANFSHNALKQCDLPHMPLLNRLELGHN 183

  Fly   112 ---ERSFAYHAKLQELHLDHNKIGQVSNKTFLGLSTISVLNLRGNLIAELEYRTFSPMVKLAELN 173
               ..:|....:||||.|:.|::.|:....|.||..:..|.|.||.::.:...||.|:.:|.:||
  Fly   184 RLVNATFGVCPQLQELILNDNQLIQLDVNAFRGLHGLLELQLSGNRLSSIGLETFQPLAQLRKLN 248

  Fly   174 LGQNRISHIDPHALDGLDN----------------------------LRVLYLDDNTLTTV-PGE 209
            |.||.:..:.|:....:.|                            |::|.:..|::.:: |..
  Fly   249 LSQNALDALRPNVFGAVQNFVLHLQQLDLSGNRIRLLFDNQFRVLARLQMLDVSRNSIASLSPAH 313

  Fly   210 LTFQALHSLAELYLGTNSFMTIPGGAFQDLKGLTRLDLRGAGLHNISGDALKG--LVSLRFLDLS 272
              |..|.||.:|||..|:.:.|....|..|..|..|||....|..:......|  |..:|.|:|:
  Fly   314 --FVGLGSLRKLYLQYNAILEIKPATFAALLNLDTLDLSYNNLEFLEEQIFGGNTLPRMRRLNLN 376

  Fly   273 DNRLPAIPTAAFQRLGRLEQLNIGQNDFEVISSGAFSGLRELRHLELTGAQRLRRVESGAFSGNT 337
            .||:..:...||..|..||.|.:|.|:.:.:....|:.:|.|:.|.|               |:.
  Fly   377 GNRMKHLHPLAFSSLPFLEYLKLGHNELKSLDVRMFAPMRRLQKLHL---------------GHN 426

  Fly   338 NLEHLNLSSNKQLNELSSIALGGLPHLSTVVLKANQLSSLDEGLVPWADLQTLDLSENPFECDCR 402
            .||.:||.   .|..|||:        ..:::..|:|:.|.:..|.:.:|:.:.:..||::|.| 
  Fly   427 LLEEINLD---VLESLSSV--------QEILVDNNRLTFLAKVNVSFPNLKRVAIEGNPWQCPC- 479

  Fly   403 LLWLRHLLVSRNA------SGQY 419
            .:.|:|.|.:|:.      :|.|
  Fly   480 FVKLQHWLATRDVVYLRDNTGYY 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
capsNP_001303391.1 leucine-rich repeat 75..96 CDD:275380 5/23 (22%)
LRR_8 96..155 CDD:290566 20/76 (26%)
leucine-rich repeat 97..120 CDD:275380 6/40 (15%)
leucine-rich repeat 121..144 CDD:275380 10/22 (45%)
LRR_8 143..201 CDD:290566 17/85 (20%)
leucine-rich repeat 145..168 CDD:275380 7/22 (32%)
LRR_RI 147..397 CDD:238064 70/280 (25%)
leucine-rich repeat 169..192 CDD:275380 7/22 (32%)
leucine-rich repeat 193..217 CDD:275380 6/24 (25%)
LRR_8 217..276 CDD:290566 20/60 (33%)
leucine-rich repeat 218..241 CDD:275380 8/22 (36%)
leucine-rich repeat 242..265 CDD:275380 7/24 (29%)
LRR_8 265..321 CDD:290566 18/55 (33%)
leucine-rich repeat 266..289 CDD:275380 8/22 (36%)
leucine-rich repeat 290..313 CDD:275380 6/22 (27%)
LRR_8 312..374 CDD:290566 14/61 (23%)
leucine-rich repeat 314..335 CDD:275380 3/20 (15%)
leucine-rich repeat 339..363 CDD:275380 8/23 (35%)
LRRCT 395..445 CDD:214507 10/31 (32%)
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 42/167 (25%)
LRR_8 104..164 CDD:290566 16/74 (22%)
leucine-rich repeat 106..129 CDD:275380 5/35 (14%)
leucine-rich repeat 130..153 CDD:275380 5/24 (21%)
leucine-rich repeat 154..195 CDD:275380 6/40 (15%)
LRR_RI 194..455 CDD:238064 76/288 (26%)
LRR_8 194..254 CDD:290566 23/59 (39%)
leucine-rich repeat 196..219 CDD:275380 10/22 (45%)
leucine-rich repeat 220..243 CDD:275380 7/22 (32%)
leucine-rich repeat 244..267 CDD:275380 7/22 (32%)
LRR_8 271..330 CDD:290566 12/60 (20%)
leucine-rich repeat 272..295 CDD:275380 0/22 (0%)
leucine-rich repeat 296..319 CDD:275380 6/24 (25%)
LRR_8 319..380 CDD:290566 20/60 (33%)
leucine-rich repeat 320..343 CDD:275380 8/22 (36%)
leucine-rich repeat 344..369 CDD:275380 7/24 (29%)
LRR_8 368..428 CDD:290566 19/74 (26%)
leucine-rich repeat 370..393 CDD:275380 8/22 (36%)
leucine-rich repeat 394..417 CDD:275380 6/22 (27%)
leucine-rich repeat 418..441 CDD:275380 10/40 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472910
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.