DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caps and 18w

DIOPT Version :9

Sequence 1:NP_001303391.1 Gene:caps / 39493 FlyBaseID:FBgn0023095 Length:811 Species:Drosophila melanogaster
Sequence 2:NP_476814.1 Gene:18w / 37277 FlyBaseID:FBgn0004364 Length:1385 Species:Drosophila melanogaster


Alignment Length:573 Identity:139/573 - (24%)
Similarity:211/573 - (36%) Gaps:175/573 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 APHLGQAFSLCLCLCLCLVLATLPVALGLANCPNGCECDDDTLMVNCGEGTLDV-------LPIA 69
            |..||.:..||             ....|:|. ||.......|.      ||||       ||.|
  Fly   184 AEFLGFSEKLC-------------AGSALSNA-NGAVSGGSELQ------TLDVSFNELRSLPDA 228

  Fly    70 LNPA----IQRLVIKNNKLKTI-DSSMQFYAQLTFLDLSFNDMLTIPERSFAYHAKLQELHLDHN 129
            ...:    :|.|.:::|.:.|: .:::...:.|..|::|:|.::::|..:||.:.:|:||||..|
  Fly   229 WGASRLRRLQTLSLQHNNISTLAPNALAGLSSLRVLNISYNHLVSLPSEAFAGNKELRELHLQGN 293

  Fly   130 KIGQ--------------------------VSNKTFLGLSTISVLNLRGNLIAELEYRTFSPMVK 168
            .:.:                          |.|.||.||..:.||||..|.:..:..:||..:..
  Fly   294 DLYELPKGLLHRLEQLLVLDLSGNQLTSHHVDNSTFAGLIRLIVLNLSNNALTRIGSKTFKELYF 358

  Fly   169 LAELNLGQNRISHIDPHALDGLDNLRVLYLDDNTLTTVPGELTFQALHSLAELYLGTNSFMTIPG 233
            |..|::..|.|.||:..|...|.||..|.|.:|.|.|:...: |..|:.|.:|.|..|....:..
  Fly   359 LQILDMRNNSIGHIEEGAFLPLYNLHTLNLAENRLHTLDNRI-FNGLYVLTKLTLNNNLVSIVES 422

  Fly   234 GAFQDLKGLTRLDLRGAGLHNISGDALKGLVSLRFLDLSDNRLPAIPTAAFQRLGRLEQLNIGQN 298
            .||::...|..|||....|..:. :|::.|..|:.|||.:|::.......|:.|.:|..|.:..|
  Fly   423 QAFRNCSDLKELDLSSNQLTEVP-EAVQDLSMLKTLDLGENQISEFKNNTFRNLNQLTGLRLIDN 486

  Fly   299 DFEVISSGAFSGLRELRHLELTGAQRLRRVESGAFSGNTNLEHLNLSSNKQLNELSSIALGGLPH 363
            ....|:.|.|..|..|..|.| ...|::.:|.|||..||.:|.:.|..| .|.:::.| ...|..
  Fly   487 RIGNITVGMFQDLPRLSVLNL-AKNRIQSIERGAFDKNTEIEAIRLDKN-FLTDINGI-FATLAS 548

  Fly   364 LSTVVLKANQLSSLDEGLVP----WADLQ--------------------TLDLSE---------- 394
            |..:.|..|.|...|...:|    |.|:.                    |||.|.          
  Fly   549 LLWLNLSENHLVWFDYAFIPSNLKWLDIHGNYIEALGNYYKLQEEIRVTTLDASHNRITEIGAMS 613

  Fly   395 ----------------------------------------------------------------- 394
                                                                             
  Fly   614 VPNSIELLFINNNIIGQIQANTFVDKTRLARVDLYANVLSKISLNALRVAPVSAEKPVPEFYLGG 678

  Fly   395 NPFECDCRLLWLRHL--LVSRNASGQYAPVI------CAYPTALRDLPLAHLA 439
            |||||||.:.||:.:  |.:|    |:..|:      |..|.: |..||..||
  Fly   679 NPFECDCSMEWLQRINNLTTR----QHPHVVDLGNIECLMPHS-RSAPLRPLA 726

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
capsNP_001303391.1 leucine-rich repeat 75..96 CDD:275380 4/21 (19%)
LRR_8 96..155 CDD:290566 24/84 (29%)
leucine-rich repeat 97..120 CDD:275380 7/22 (32%)
leucine-rich repeat 121..144 CDD:275380 12/48 (25%)
LRR_8 143..201 CDD:290566 19/57 (33%)
leucine-rich repeat 145..168 CDD:275380 7/22 (32%)
LRR_RI 147..397 CDD:238064 80/348 (23%)
leucine-rich repeat 169..192 CDD:275380 8/22 (36%)
leucine-rich repeat 193..217 CDD:275380 8/23 (35%)
LRR_8 217..276 CDD:290566 18/58 (31%)
leucine-rich repeat 218..241 CDD:275380 6/22 (27%)
leucine-rich repeat 242..265 CDD:275380 7/22 (32%)
LRR_8 265..321 CDD:290566 17/55 (31%)
leucine-rich repeat 266..289 CDD:275380 7/22 (32%)
leucine-rich repeat 290..313 CDD:275380 7/22 (32%)
LRR_8 312..374 CDD:290566 19/61 (31%)
leucine-rich repeat 314..335 CDD:275380 8/20 (40%)
leucine-rich repeat 339..363 CDD:275380 6/23 (26%)
LRRCT 395..445 CDD:214507 20/53 (38%)
18wNP_476814.1 leucine-rich repeat 66..91 CDD:275380
leucine-rich repeat 92..115 CDD:275380
LRR_8 115..181 CDD:290566
leucine-rich repeat 116..146 CDD:275380
leucine-rich repeat 147..170 CDD:275380
leucine-rich repeat 171..201 CDD:275380 6/29 (21%)
LRR_RI 210..464 CDD:238064 73/261 (28%)
leucine-rich repeat 212..236 CDD:275380 8/29 (28%)
LRR_8 235..295 CDD:290566 17/59 (29%)
leucine-rich repeat 237..260 CDD:275380 4/22 (18%)
leucine-rich repeat 261..284 CDD:275380 7/22 (32%)
LRR_8 283..345 CDD:290566 17/61 (28%)
leucine-rich repeat 285..308 CDD:275380 6/22 (27%)
leucine-rich repeat 309..334 CDD:275380 6/24 (25%)
LRR_8 334..393 CDD:290566 20/58 (34%)
leucine-rich repeat 335..358 CDD:275380 7/22 (32%)
leucine-rich repeat 359..382 CDD:275380 8/22 (36%)
LRR_8 382..441 CDD:290566 19/59 (32%)
leucine-rich repeat 383..406 CDD:275380 8/23 (35%)
leucine-rich repeat 407..430 CDD:275380 6/22 (27%)
LRR_8 431..488 CDD:290566 17/57 (30%)
leucine-rich repeat 431..451 CDD:275380 6/20 (30%)
leucine-rich repeat 454..477 CDD:275380 7/22 (32%)
LRR_8 477..559 CDD:290566 26/84 (31%)
leucine-rich repeat 478..499 CDD:275380 6/20 (30%)
leucine-rich repeat 502..525 CDD:275380 9/23 (39%)
leucine-rich repeat 526..548 CDD:275380 6/23 (26%)
leucine-rich repeat 590..617 CDD:275380 4/26 (15%)
leucine-rich repeat 618..641 CDD:275380 0/22 (0%)
leucine-rich repeat 642..689 CDD:275380 7/46 (15%)
LRRCT 679..736 CDD:214507 20/53 (38%)
leucine-rich repeat 775..796 CDD:275380
LRR_8 797..852 CDD:290566
leucine-rich repeat 797..817 CDD:275380
leucine-rich repeat 818..841 CDD:275380
LRR_8 841..900 CDD:290566
leucine-rich repeat 842..865 CDD:275380
LRR_4 866..907 CDD:289563
leucine-rich repeat 866..889 CDD:275380
leucine-rich repeat 890..911 CDD:275380
TIR 1045..1183 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453542
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.