DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caps and rdo

DIOPT Version :9

Sequence 1:NP_001303391.1 Gene:caps / 39493 FlyBaseID:FBgn0023095 Length:811 Species:Drosophila melanogaster
Sequence 2:NP_001286024.1 Gene:rdo / 35077 FlyBaseID:FBgn0243486 Length:757 Species:Drosophila melanogaster


Alignment Length:844 Identity:199/844 - (23%)
Similarity:300/844 - (35%) Gaps:229/844 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 FSLCLCLCLCLVLATLPVALG--LANCPNGCEC--DD-DTLMVNCGEGTLDVL------------ 66
            ||||:          :|....  ...||..|:|  || |.....|.:|.|:.|            
  Fly     8 FSLCI----------MPAMFSNTKRKCPTECQCSMDDLDRYQAICTKGGLNSLLSPNELDVDVKV 62

  Fly    67 --------PIALNPAIQRLVIKNNKLKTIDSSM------QFYA--QLTFLDLSFNDMLTIPERSF 115
                    .|.:.||: |..:|...|:..||::      .|:.  .|..||||.|::..|.|.:|
  Fly    63 IIIRGPRNSITIGPAL-RQFMKLEILRITDSNLPAIGAESFWGLKYLRILDLSKNNITNITENNF 126

  Fly   116 AYHAKLQELHLDHNKIGQVSNKTFLGLSTISVLNLRGNLIAELEYRTFSPMVKLAELNLGQNRIS 180
            .....|.||.|..||:.::::.||..|:.:..|||..|.|.||..|.|..:.:|..|:|..|.:.
  Fly   127 RGQDNLLELDLSKNKVLRMASSTFRHLTDLRRLNLADNSIVELVQRNFFMLSRLKYLDLSGNPLQ 191

  Fly   181 HIDPHALDGLDNLRVLYLDDNTLTTVPGELTFQALHSLAELYLGTNSFMTIPGGAFQDLKGLTRL 245
            .:.|.....:..|:||...:..|..:..:: :..|..|:||.||.|.|..:....|:|:|.||::
  Fly   192 DLQPDVFRDVPELKVLKCRNCQLKKINPQM-YNLLPLLSELDLGRNEFKFLDKDEFRDVKRLTKV 255

  Fly   246 DLRGAGLHNISGDALKGLVSLRFLDLSDNRLPAIPTAAFQRLGRLEQLNIGQNDFE--------- 301
            .|.|..|..:.....:...||..||||.|||..:|..:|.:|..|..|::..|...         
  Fly   256 LLDGNQLSVVVDQLFRMQKSLNHLDLSYNRLAKVPNDSFLQLTNLTFLDLSYNKLVRLEPQSIRS 320

  Fly   302 -------VISSGAFSGLRELR--------------------------HLELTGAQRLRRVESGAF 333
                   .||......|||:|                          ||.:..   :..:..|..
  Fly   321 LSNLLTLNISGNVLMDLREMRETFEPLIYYFFLTCSKLFFQLIPQLTHLAIAD---MGTMPVGLL 382

  Fly   334 SGNTNLEHLNLSSNKQLNELSSIALGGLPHLSTVVLKANQLSSLDEGLV-PWADLQTLDLSENPF 397
            .....|.:||:|.| .||..:...:.....|..:.|..|||..:.|..| ....::.:.|..||.
  Fly   383 HPFKQLRYLNISGN-SLNNTALEVIDPCRELEFLDLSRNQLHGISEDTVLRIQGIRNVRLDNNPL 446

  Fly   398 ECD-CRLLWLRHLLVSRNASGQYAPVICAYPTALRDLPLAHL-AEPLLGC--------------- 445
            .|| |.:..|.:::..........| ||..|.:||...:.:| ...|..|               
  Fly   447 ICDECHMGKLINVVRQLQWKWDTYP-ICFLPKSLRGAEINNLDINGLHTCLTFITDEEQNAASTS 510

  Fly   446 ----AHGAASKQAII-GILVVACAALITTLALVLYTCRHRIREMLKGHSALGRKEREYQKTFSDE 505
                .||..:..||: ||:.|..|.:|  |:||....::|.|                  .::.|
  Fly   511 YNFLEHGGLNTLAILGGIIFVLIAVII--LSLVACFSKNRAR------------------YYTRE 555

  Fly   506 EYMSRPPPGGGGVHPAAGGYPYIAGNSRMIPVTELXLEAPPPPQLRGRGGGGGASTASGAVQQLQ 570
            ::::                   ...|:.:   |..|||.....|    |.|.:.|.:..:....
  Fly   556 DHLN-------------------GSESKCL---EKNLEATTITTL----GNGSSPTTTTTLTLAT 594

  Fly   571 VPSAVDQASNSFAQLSHIHYMTNNGQQQQAQQQQSTSKMHHSQQDMRLLACNGGKPLNATSLPRH 635
            .|:|.:...             .|||.........::.:|....|.       ||.:|.|.....
  Fly   595 SPAAPNGPK-------------TNGQGLSLSPANGSTPVHGISDDK-------GKEINFTFPVDD 639

  Fly   636 RPPVVQESTLSHYSQPLANGIRLTQDHFNHNQNQ-----SHNQHYGGVYAKPCDAMS--EPGYIH 693
            |...:.|...|....|        |.|.:.|...     ||:.:.....|....|.:  .||   
  Fly   640 RVCTIDELMPSPPPPP--------QQHPHPNMGSLMYSVSHSPNSATTLAAVAAAATVIPPG--- 693

  Fly   694 NNSHYSLPLDHDLPPSPTPTP--------PPPALP--------------LRNGVGMALIHGNTT 735
            ..||.|:       |:|||||        |||.||              ||. |...|:|.::|
  Fly   694 APSHSSM-------PTPTPTPAEAVVVVLPPPPLPPQQHHHQMDGSLASLRE-VQQQLVHLSST 749

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
capsNP_001303391.1 leucine-rich repeat 75..96 CDD:275380 6/28 (21%)
LRR_8 96..155 CDD:290566 22/58 (38%)
leucine-rich repeat 97..120 CDD:275380 9/22 (41%)
leucine-rich repeat 121..144 CDD:275380 9/22 (41%)
LRR_8 143..201 CDD:290566 17/57 (30%)
leucine-rich repeat 145..168 CDD:275380 9/22 (41%)
LRR_RI 147..397 CDD:238064 74/292 (25%)
leucine-rich repeat 169..192 CDD:275380 5/22 (23%)
leucine-rich repeat 193..217 CDD:275380 5/23 (22%)
LRR_8 217..276 CDD:290566 22/58 (38%)
leucine-rich repeat 218..241 CDD:275380 9/22 (41%)
leucine-rich repeat 242..265 CDD:275380 5/22 (23%)
LRR_8 265..321 CDD:290566 23/97 (24%)
leucine-rich repeat 266..289 CDD:275380 11/22 (50%)
leucine-rich repeat 290..313 CDD:275380 6/38 (16%)
LRR_8 312..374 CDD:290566 16/87 (18%)
leucine-rich repeat 314..335 CDD:275380 4/46 (9%)
leucine-rich repeat 339..363 CDD:275380 7/23 (30%)
LRRCT 395..445 CDD:214507 14/51 (27%)
rdoNP_001286024.1 leucine-rich repeat 84..107 CDD:275380 4/22 (18%)
leucine-rich repeat 108..131 CDD:275380 9/22 (41%)
LRR_8 131..190 CDD:290566 22/58 (38%)
leucine-rich repeat 132..155 CDD:275380 9/22 (41%)
LRR_RI 151..422 CDD:238064 69/275 (25%)
leucine-rich repeat 156..179 CDD:275380 9/22 (41%)
LRR_8 178..262 CDD:290566 24/84 (29%)
leucine-rich repeat 180..203 CDD:275380 5/22 (23%)
leucine-rich repeat 204..251 CDD:275380 14/47 (30%)
leucine-rich repeat 252..275 CDD:275380 5/22 (23%)
LRR_8 274..334 CDD:290566 17/59 (29%)
leucine-rich repeat 276..299 CDD:275380 11/22 (50%)
LRR_4 298..342 CDD:289563 8/43 (19%)
leucine-rich repeat 300..323 CDD:275380 3/22 (14%)
leucine-rich repeat 388..411 CDD:275380 7/23 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453576
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.