DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caps and CG16974

DIOPT Version :9

Sequence 1:NP_001303391.1 Gene:caps / 39493 FlyBaseID:FBgn0023095 Length:811 Species:Drosophila melanogaster
Sequence 2:NP_001246018.1 Gene:CG16974 / 34713 FlyBaseID:FBgn0032479 Length:1257 Species:Drosophila melanogaster


Alignment Length:418 Identity:117/418 - (27%)
Similarity:181/418 - (43%) Gaps:73/418 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 ECDDDTLM---------------VNCGEGTLDVLPIALNPAIQRLVIKNNKLKTIDSSMQFYAQL 97
            |..|:|||               :|..|..|:.|..|:..|::|:.:                  
  Fly   185 ELKDETLMELFTRQPRSFEYMERLNLAENRLECLHWAIPLAVRRVKV------------------ 231

  Fly    98 TFLDLSFNDMLTIPERSFAYHAKLQELHLDHNKIGQVSNKTFLG-LSTISVLNLRGNLIAELEYR 161
              |::|.|.:......:..|..:|||||||.:::..:..: ||| ||.:.:|||..||:.||...
  Fly   232 --LEMSGNRLSNCSLLNLQYMKQLQELHLDRSELTYLPQR-FLGELSELRMLNLSQNLLTELPRD 293

  Fly   162 TFSPMVKLAELNLGQNRISHI---------DPHALDGLDN---------------LRVLYLDDNT 202
            .|...:||..|.|..||:|.:         |...||..||               ||.|:|..|.
  Fly   294 IFVGALKLERLYLSGNRLSVLPFMLFQTAADLQVLDLSDNRLLSFPDNFFARNGQLRQLHLQRNQ 358

  Fly   203 LTTVPGELTFQALHSLAELYLGTNSFMTIPGGAFQDLKGLTRLDLRGAGLHNISGDALKGLVSLR 267
            |.:: |:.:..:|..|.:|.|..||...|...||:.|..|..|::.|..|..:|....:.|.:||
  Fly   359 LKSI-GKHSLYSLRELRQLDLSQNSLSVIDRKAFESLDHLLALNVSGNNLTLLSSIIFQSLHALR 422

  Fly   268 FLDLSDNRLPAIPTAAFQRLGRLEQLNIGQNDFEVISSGAF---------SGLRELRHLELTGAQ 323
            .||||.|:...:|:..|||...|..|.|.:...|..|:...         ..|..||:|.:...:
  Fly   423 QLDLSRNQFKQLPSGLFQRQRSLVLLRIDETPIEQFSNWISRYDESLVDPQVLHRLRYLSVQQNR 487

  Fly   324 RLRRVESGAFSGNTNLEHLNLSSNKQLNELSSIALGGLPHLSTVVLKANQLSSLDEGLVPWADLQ 388
            :|..:.:..|:...|:..|.|:.|..|...:.|:  ||..|..:.::.|.|.||.|.:.....|.
  Fly   488 KLTYLPATLFANTPNIRELLLAENGLLQLPTQIS--GLSRLQRLSVRGNSLGSLPENIKELRQLH 550

  Fly   389 TLDLSENPFECDCRLLWLRHLLVSRNAS 416
            .|::..|.::|||.:.||...|.:.:.|
  Fly   551 YLNILGNEYQCDCSMYWLTAWLANTSTS 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
capsNP_001303391.1 leucine-rich repeat 75..96 CDD:275380 1/20 (5%)
LRR_8 96..155 CDD:290566 20/59 (34%)
leucine-rich repeat 97..120 CDD:275380 4/22 (18%)
leucine-rich repeat 121..144 CDD:275380 11/23 (48%)
LRR_8 143..201 CDD:290566 25/81 (31%)
leucine-rich repeat 145..168 CDD:275380 8/22 (36%)
LRR_RI 147..397 CDD:238064 82/282 (29%)
leucine-rich repeat 169..192 CDD:275380 9/31 (29%)
leucine-rich repeat 193..217 CDD:275380 8/23 (35%)
LRR_8 217..276 CDD:290566 22/58 (38%)
leucine-rich repeat 218..241 CDD:275380 9/22 (41%)
leucine-rich repeat 242..265 CDD:275380 6/22 (27%)
LRR_8 265..321 CDD:290566 20/64 (31%)
leucine-rich repeat 266..289 CDD:275380 11/22 (50%)
leucine-rich repeat 290..313 CDD:275380 6/31 (19%)
LRR_8 312..374 CDD:290566 15/61 (25%)
leucine-rich repeat 314..335 CDD:275380 5/20 (25%)
leucine-rich repeat 339..363 CDD:275380 7/23 (30%)
LRRCT 395..445 CDD:214507 8/22 (36%)
CG16974NP_001246018.1 leucine-rich repeat 206..228 CDD:275380 6/21 (29%)
leucine-rich repeat 229..252 CDD:275380 4/42 (10%)
LRR_RI <246..433 CDD:238064 63/188 (34%)
LRR_8 251..311 CDD:290566 25/60 (42%)
leucine-rich repeat 253..276 CDD:275380 11/23 (48%)
leucine-rich repeat 277..300 CDD:275380 8/22 (36%)
leucine-rich repeat 301..324 CDD:275380 6/22 (27%)
LRR_8 325..383 CDD:290566 16/58 (28%)
leucine-rich repeat 325..348 CDD:275380 4/22 (18%)
leucine-rich repeat 349..372 CDD:275380 8/23 (35%)
LRR_RI 351..>557 CDD:238064 59/208 (28%)
LRR_8 371..431 CDD:290566 22/59 (37%)
leucine-rich repeat 373..396 CDD:275380 9/22 (41%)
leucine-rich repeat 397..420 CDD:275380 6/22 (27%)
leucine-rich repeat 421..444 CDD:275380 11/22 (50%)
LRR_8 477..536 CDD:290566 15/60 (25%)
leucine-rich repeat 478..502 CDD:275380 5/23 (22%)
leucine-rich repeat 503..526 CDD:275380 7/24 (29%)
Ig <714..761 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453568
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.