DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caps and LINGO4

DIOPT Version :9

Sequence 1:NP_001303391.1 Gene:caps / 39493 FlyBaseID:FBgn0023095 Length:811 Species:Drosophila melanogaster
Sequence 2:NP_001004432.1 Gene:LINGO4 / 339398 HGNCID:31814 Length:593 Species:Homo sapiens


Alignment Length:428 Identity:129/428 - (30%)
Similarity:187/428 - (43%) Gaps:44/428 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LVLATLPVALGLANCPNGCECDDDTLMVNCGEGTLDVLPIALNPAIQRLVIKNNKLKTIDSSM-Q 92
            |.|..||...| .:||..|:|......|.||...|:.:|..|....:.|.:..|:|..:...| .
Human    18 LFLLLLPGGSG-GSCPAVCDCTSQPQAVLCGHRQLEAVPGGLPLDTELLDLSGNRLWGLQQGMLS 81

  Fly    93 FYAQLTFLDLSFNDMLTIPERSFAYHAKLQELHLDHNKIGQVSNKTFLGLSTISVLNLRGNLIAE 157
            ..:.|..||||:|.:.|:...:|.....|..|.|..|::..:....|.|||.:::|:||.|.|..
Human    82 RLSLLQELDLSYNQLSTLEPGAFHGLQSLLTLRLQGNRLRIMGPGVFSGLSALTLLDLRLNQIVL 146

  Fly   158 LEYRTFSPMVKLAELNLGQNRISHIDPHALDGLDNLRVLYLDDNTLTTVPGELTFQALHSLAELY 222
            .....|..:..|.:|.:|.|.:..:.|.|..||..|..|.|:...|:|||| |....|.:|..|.
Human   147 FLDGAFGELGSLQKLEVGDNHLVFVAPGAFAGLAKLSTLTLERCNLSTVPG-LALARLPALVALR 210

  Fly   223 LGTNSFMTIPGGAFQDLKGLTRLDLR-GAGLHNISGDALKGLVSLRFLDLSDNRLPAIPTAAFQR 286
            |.......:|.||.:.|..|..|::. ...|..:...:|.|| :|..|.::...|.::|..|...
Human   211 LRELDIGRLPAGALRGLGQLKELEIHLWPSLEALDPGSLVGL-NLSSLAITRCNLSSVPFQALYH 274

  Fly   287 LGRLEQLNIGQNDFEVISSGAFSGLRELRHLELTGAQRLRRVESGAFSGNTNLEHLNLSSNKQLN 351
            |..|..|::.||....|.:...|.|..|:.|.|:|| .|..:.:.||.|.|....|:::.     
Human   275 LSFLRVLDLSQNPISAIPARRLSPLVRLQELRLSGA-CLTSIAAHAFHGLTAFHLLDVAD----- 333

  Fly   352 ELSSIALGGLPHLSTVVLKANQLSSLDEGLVPWAD-LQTLDLSENPFECDCRLLWLRHLLVSRNA 415
                                |.|.:|:|...|..| |.||.||.||..||||||||  |.:.|:.
Human   334 --------------------NALQTLEETAFPSPDKLVTLRLSGNPLTCDCRLLWL--LRLRRHL 376

  Fly   416 SGQYAPVICAYP-----TALRD----LPLAHL-AEPLL 443
            ....:|..||.|     .:|::    ||..|. .:|.|
Human   377 DFGMSPPACAGPHHVQGKSLKEFSDILPPGHFTCKPAL 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
capsNP_001303391.1 leucine-rich repeat 75..96 CDD:275380 4/21 (19%)
LRR_8 96..155 CDD:290566 20/58 (34%)
leucine-rich repeat 97..120 CDD:275380 8/22 (36%)
leucine-rich repeat 121..144 CDD:275380 7/22 (32%)
LRR_8 143..201 CDD:290566 18/57 (32%)
leucine-rich repeat 145..168 CDD:275380 6/22 (27%)
LRR_RI 147..397 CDD:238064 73/251 (29%)
leucine-rich repeat 169..192 CDD:275380 8/22 (36%)
leucine-rich repeat 193..217 CDD:275380 10/23 (43%)
LRR_8 217..276 CDD:290566 15/59 (25%)
leucine-rich repeat 218..241 CDD:275380 7/22 (32%)
leucine-rich repeat 242..265 CDD:275380 6/23 (26%)
LRR_8 265..321 CDD:290566 16/55 (29%)
leucine-rich repeat 266..289 CDD:275380 6/22 (27%)
leucine-rich repeat 290..313 CDD:275380 7/22 (32%)
LRR_8 312..374 CDD:290566 12/61 (20%)
leucine-rich repeat 314..335 CDD:275380 8/20 (40%)
leucine-rich repeat 339..363 CDD:275380 1/23 (4%)
LRRCT 395..445 CDD:214507 22/59 (37%)
LINGO4NP_001004432.1 LRRNT 31..64 CDD:214470 10/32 (31%)
leucine-rich repeat 62..85 CDD:275380 4/22 (18%)
LRR_8 65..120 CDD:290566 16/54 (30%)
leucine-rich repeat 86..109 CDD:275380 8/22 (36%)
LRR_RI 87..320 CDD:238064 71/235 (30%)
LRR_8 109..168 CDD:290566 18/58 (31%)
leucine-rich repeat 110..133 CDD:275380 7/22 (32%)
leucine-rich repeat 134..157 CDD:275380 6/22 (27%)
LRR_8 157..212 CDD:290566 20/55 (36%)
leucine-rich repeat 158..181 CDD:275380 8/22 (36%)
leucine-rich repeat 182..205 CDD:275380 10/23 (43%)
leucine-rich repeat 206..229 CDD:275380 7/22 (32%)
leucine-rich repeat 230..277 CDD:275380 12/47 (26%)
LRR_8 253..309 CDD:290566 16/55 (29%)
leucine-rich repeat 278..301 CDD:275380 7/22 (32%)
LRR_8 301..360 CDD:290566 23/84 (27%)
leucine-rich repeat 302..325 CDD:275380 9/23 (39%)
leucine-rich repeat 326..344 CDD:275380 5/42 (12%)
leucine-rich repeat 350..362 CDD:275378 7/11 (64%)
IG_like 420..501 CDD:214653
Ig 431..501 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1280
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.