| Sequence 1: | NP_001303391.1 | Gene: | caps / 39493 | FlyBaseID: | FBgn0023095 | Length: | 811 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001305406.1 | Gene: | TSKU / 25987 | HGNCID: | 28850 | Length: | 367 | Species: | Homo sapiens |
| Alignment Length: | 318 | Identity: | 87/318 - (27%) |
|---|---|---|---|
| Similarity: | 135/318 - (42%) | Gaps: | 58/318 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 29 LVLATLPVALGLANCPNGCECDDDTL---------MVNCGEGTLDVLPIALNPAIQRLVIKNNKL 84
Fly 85 KTIDSSM---QFYAQLTFLDLSFNDMLTIPERSFAYHAKLQELHLDHNKIGQVSNKTFLGLSTIS 146
Fly 147 VLNLRGNLIAELEYRTFS-----------------------------PMVKLAELNLGQNRISHI 182
Fly 183 DPHALDGLDN--LRVLYLDDNTLTTV-PGELTFQALHSLAELYLGTNSFMTIP---GGAFQDLKG 241
Fly 242 LTRLDLRGAGLHNISG-DALKGLVSLRFLDLSDNRLPAIPTAAFQRLGRLEQLNIGQN 298 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| caps | NP_001303391.1 | leucine-rich repeat | 75..96 | CDD:275380 | 5/23 (22%) |
| LRR_8 | 96..155 | CDD:290566 | 19/58 (33%) | ||
| leucine-rich repeat | 97..120 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 121..144 | CDD:275380 | 6/22 (27%) | ||
| LRR_8 | 143..201 | CDD:290566 | 21/88 (24%) | ||
| leucine-rich repeat | 145..168 | CDD:275380 | 7/51 (14%) | ||
| LRR_RI | 147..397 | CDD:238064 | 55/188 (29%) | ||
| leucine-rich repeat | 169..192 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 193..217 | CDD:275380 | 11/24 (46%) | ||
| LRR_8 | 217..276 | CDD:290566 | 23/62 (37%) | ||
| leucine-rich repeat | 218..241 | CDD:275380 | 7/25 (28%) | ||
| leucine-rich repeat | 242..265 | CDD:275380 | 9/23 (39%) | ||
| LRR_8 | 265..321 | CDD:290566 | 13/34 (38%) | ||
| leucine-rich repeat | 266..289 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 290..313 | CDD:275380 | 3/9 (33%) | ||
| LRR_8 | 312..374 | CDD:290566 | |||
| leucine-rich repeat | 314..335 | CDD:275380 | |||
| leucine-rich repeat | 339..363 | CDD:275380 | |||
| LRRCT | 395..445 | CDD:214507 | |||
| TSKU | NP_001305406.1 | LRR_RI | 52..305 | CDD:238064 | 72/262 (27%) |
| leucine-rich repeat | 76..99 | CDD:275380 | 5/22 (23%) | ||
| leucine-rich repeat | 100..123 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 103..157 | CDD:290566 | 18/54 (33%) | ||
| leucine-rich repeat | 124..145 | CDD:275380 | 6/21 (29%) | ||
| leucine-rich repeat | 147..170 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 171..197 | CDD:275380 | 0/25 (0%) | ||
| leucine-rich repeat | 200..219 | CDD:275380 | 8/23 (35%) | ||
| LRR_8 | 221..279 | CDD:290566 | 24/61 (39%) | ||
| leucine-rich repeat | 221..244 | CDD:275380 | 11/24 (46%) | ||
| leucine-rich repeat | 245..269 | CDD:275380 | 7/25 (28%) | ||
| LRR_8 | 268..321 | CDD:290566 | 21/52 (40%) | ||
| leucine-rich repeat | 270..294 | CDD:275380 | 9/23 (39%) | ||
| leucine-rich repeat | 295..316 | CDD:275380 | 8/20 (40%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR45617 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 2.010 | |||||