DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caps and tbce-1

DIOPT Version :9

Sequence 1:NP_001303391.1 Gene:caps / 39493 FlyBaseID:FBgn0023095 Length:811 Species:Drosophila melanogaster
Sequence 2:NP_501395.1 Gene:tbce-1 / 177624 WormBaseID:WBGene00019503 Length:493 Species:Caenorhabditis elegans


Alignment Length:417 Identity:88/417 - (21%)
Similarity:146/417 - (35%) Gaps:146/417 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 KLQELHLDHNKIGQVSNKTFLGLSTISVLNLRGNLIAE-------LEYRTFSPMVKLAELNLGQN 177
            ||..:.||:..:|...:...........|||.|||:.:       |||     ..::.||||.:|
 Worm   119 KLINIVLDNRSVGFPPSSDSPQFILCRELNLYGNLLYKWKTVRQILEY-----FPRIQELNLRRN 178

  Fly   178 RI-----------SHIDPHAL----------------DGLDNLRVLYLDDNTLTTVPGELT---- 211
            |:           |..|.|..                :.:|::.:.:...:.:.....:||    
 Worm   179 RMQCFNEEEDDDESEGDDHVYSDSCKKLVISECNLSENSIDSILLRFPSTSDVVAFGNDLTRFSV 243

  Fly   212 FQALHS-LAELYLGTNSFMTIPG--GAFQDLKGLTRLDLRGAGLHNISGDALKGLVSLRFLDLSD 273
            .:|:.| |..|.|..|.|.|:..  |.|.:   ||:|.:...|:.:::|  ..|  |::|     
 Worm   244 SEAVSSRLTSLDLEDNPFKTLDSIHGTFPN---LTQLSVANCGITSLNG--FDG--SIKF----- 296

  Fly   274 NRLPAIPTAAFQRLGRLEQLNIGQNDFEVISSGAFSGLRELRHLELTGAQRLRRVESGAFSGNTN 338
                          .:||.|||.:|  .::...:.:.:|.|:.|     :||.            
 Worm   297 --------------PKLEYLNIKRN--SIVEWKSVNSIRSLKSL-----KRLL------------ 328

  Fly   339 LEHLNLSSNKQLNELSSIALGGLPHLSTVVLKANQLSSLDEGLVPWADLQTLDLSENPFECDCRL 403
            .:...||:.|.::....:    :..|||::                 ||...|:|    |.:.|.
 Worm   329 FDCKKLSTEKGVHAYEIV----IAKLSTLI-----------------DLNRFDVS----EVERRS 368

  Fly   404 LWLRHLLVSRNASGQYAPVICAYPTALRD----------LPLAHLAEPLLGCAHGAASKQAIIGI 458
            ..:|.|       .:||        .|.|          |...| .||.|    ..|.|...:..
 Worm   369 AEIRFL-------NKYA--------GLNDNEDHQDDIKRLIEIH-GEPTL----DTAKKGLAVVK 413

  Fly   459 LVVACAALITTLALVLYTCRHRIREML 485
            :.:.|...:.|..|.|.....:||:||
 Worm   414 IRIECGNRVETRRLPLGMSIQKIRDML 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
capsNP_001303391.1 leucine-rich repeat 75..96 CDD:275380
LRR_8 96..155 CDD:290566 10/34 (29%)
leucine-rich repeat 97..120 CDD:275380 88/417 (21%)
leucine-rich repeat 121..144 CDD:275380 4/22 (18%)
LRR_8 143..201 CDD:290566 19/91 (21%)
leucine-rich repeat 145..168 CDD:275380 9/29 (31%)
LRR_RI 147..397 CDD:238064 60/290 (21%)
leucine-rich repeat 169..192 CDD:275380 9/49 (18%)
leucine-rich repeat 193..217 CDD:275380 3/27 (11%)
LRR_8 217..276 CDD:290566 17/61 (28%)
leucine-rich repeat 218..241 CDD:275380 8/24 (33%)
leucine-rich repeat 242..265 CDD:275380 6/22 (27%)
LRR_8 265..321 CDD:290566 11/55 (20%)
leucine-rich repeat 266..289 CDD:275380 1/22 (5%)
leucine-rich repeat 290..313 CDD:275380 6/22 (27%)
LRR_8 312..374 CDD:290566 11/61 (18%)
leucine-rich repeat 314..335 CDD:275380 4/20 (20%)
leucine-rich repeat 339..363 CDD:275380 3/23 (13%)
LRRCT 395..445 CDD:214507 13/59 (22%)
tbce-1NP_501395.1 CAP_GLY 3..65 CDD:214997
leucine-rich repeat 145..169 CDD:275380 9/28 (32%)
leucine-rich repeat 170..205 CDD:275380 9/34 (26%)
LRR_RI <204..372 CDD:393385 44/237 (19%)
leucine-rich repeat 206..233 CDD:275380 1/26 (4%)
leucine-rich repeat 251..273 CDD:275380 8/21 (38%)
leucine-rich repeat 274..298 CDD:275380 8/46 (17%)
leucine-rich repeat 299..323 CDD:275380 8/25 (32%)
Ubl_TBCE 410..491 CDD:340564 8/31 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.