DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caps and Lrrn3

DIOPT Version :9

Sequence 1:NP_001303391.1 Gene:caps / 39493 FlyBaseID:FBgn0023095 Length:811 Species:Drosophila melanogaster
Sequence 2:NP_001258637.1 Gene:Lrrn3 / 16981 MGIID:106036 Length:707 Species:Mus musculus


Alignment Length:395 Identity:113/395 - (28%)
Similarity:176/395 - (44%) Gaps:49/395 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VALGLA------------NCPNGCECD-----------DDTLMVNCGEGTLDVLPIALNPAIQRL 77
            |.||||            :||..|.|:           .:...|:|.:..|...|..|....|.|
Mouse    10 VLLGLAITTLVQAIDKKVDCPQLCTCEIRPWFTPRSIYMEASTVDCNDLGLLNFPARLPADTQIL 74

  Fly    78 VIKNNKLKTIDSSMQFYAQLTFLDLSFNDMLTIPERSFAYHAKLQELHLDHNKIGQVSNKTFLGL 142
            :::.|.:..|:.|..|...||.||||.|::.::...:....::|..::|:.||:.::..|...||
Mouse    75 LLQTNNIARIEHSTDFPVNLTGLDLSQNNLSSVTNINVQKMSQLLSVYLEENKLTELPEKCLYGL 139

  Fly   143 STISVLNLRGNLIAELEYRTFSPMVKLAELNLGQNRISHIDPHALDGLDNLRVLYLDDNTLTTVP 207
            |                        .|.||.:..|.:|.|.|.|..||.||..|:|:.|.|..:.
Mouse   140 S------------------------NLQELYVNHNLLSTISPGAFIGLHNLLRLHLNSNRLQMIN 180

  Fly   208 GELTFQALHSLAELYLGTNSFMTIPGGAFQDLKGLTRLDLRGAGLHNISGDALKGLVSLRFLDLS 272
            .: .|.||.:|..|.||.|..:.|....||.|..|..|.:.|..|..|..|||.||.:|..:...
Mouse   181 SQ-WFDALPNLEILMLGDNPIIRIKDMNFQPLVKLRSLVIAGINLTEIPDDALAGLENLESISFY 244

  Fly   273 DNRLPAIPTAAFQRLGRLEQLNIGQNDFEVISSGAFSGLRELRHLELTGAQRLRRVESGAFSGNT 337
            ||||..:|..|.|:...|:.|::.:|....|..|.||.:..|:.|.:.....|..::|.|.....
Mouse   245 DNRLSKVPQVALQKAVNLKFLDLNKNPINRIRRGDFSNMLHLKELGINNMPELVSIDSLAVDNLP 309

  Fly   338 NLEHLNLSSNKQLNELSSIALGGLPHLSTVVLKANQLSSLDEGLV-PWADLQTLDLSENPFECDC 401
            :|..:..::|.:|:.:...|...||.|.:::|..|.||:|..|.: ...:|:.:.:..||..|||
Mouse   310 DLRKIEATNNPRLSYIHPNAFFRLPKLESLMLNTNALSALYHGTIESLPNLKEISIHSNPIRCDC 374

  Fly   402 RLLWL 406
            .:.|:
Mouse   375 VIRWI 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
capsNP_001303391.1 leucine-rich repeat 75..96 CDD:275380 6/20 (30%)
LRR_8 96..155 CDD:290566 15/58 (26%)
leucine-rich repeat 97..120 CDD:275380 7/22 (32%)
leucine-rich repeat 121..144 CDD:275380 7/22 (32%)
LRR_8 143..201 CDD:290566 15/57 (26%)
leucine-rich repeat 145..168 CDD:275380 0/22 (0%)
LRR_RI 147..397 CDD:238064 73/250 (29%)
leucine-rich repeat 169..192 CDD:275380 10/22 (45%)
leucine-rich repeat 193..217 CDD:275380 8/23 (35%)
LRR_8 217..276 CDD:290566 22/58 (38%)
leucine-rich repeat 218..241 CDD:275380 9/22 (41%)
leucine-rich repeat 242..265 CDD:275380 10/22 (45%)
LRR_8 265..321 CDD:290566 17/55 (31%)
leucine-rich repeat 266..289 CDD:275380 8/22 (36%)
leucine-rich repeat 290..313 CDD:275380 7/22 (32%)
LRR_8 312..374 CDD:290566 14/61 (23%)
leucine-rich repeat 314..335 CDD:275380 5/20 (25%)
leucine-rich repeat 339..363 CDD:275380 5/23 (22%)
LRRCT 395..445 CDD:214507 6/12 (50%)
Lrrn3NP_001258637.1 LRRNT 28..72 CDD:214470 9/43 (21%)
LRR 1 70..91 5/20 (25%)
leucine-rich repeat 72..93 CDD:275380 6/20 (30%)
LRR_8 93..152 CDD:290566 19/82 (23%)
LRR 2 93..114 7/20 (35%)
leucine-rich repeat 94..117 CDD:275380 7/22 (32%)
LRR 3 117..138 5/20 (25%)
leucine-rich repeat 118..141 CDD:275380 8/46 (17%)
LRR 139..160 CDD:197688 9/44 (20%)
LRR 4 141..162 8/20 (40%)
leucine-rich repeat 142..165 CDD:275380 10/22 (45%)
LRR 5 165..186 7/21 (33%)
leucine-rich repeat 166..189 CDD:275380 8/23 (35%)
LRR_8 173..221 CDD:290566 16/48 (33%)
LRR 6 189..210 7/20 (35%)
leucine-rich repeat 190..213 CDD:275380 9/22 (41%)
LRR_8 213..272 CDD:290566 21/58 (36%)
LRR 7 213..234 8/20 (40%)
leucine-rich repeat 214..237 CDD:275380 10/22 (45%)
LRR 8 237..258 7/20 (35%)
leucine-rich repeat 238..261 CDD:275380 8/22 (36%)
LRR 9 261..282 6/20 (30%)
leucine-rich repeat 262..285 CDD:275380 7/22 (32%)
LRR 10 285..304 4/18 (22%)
leucine-rich repeat 286..310 CDD:275380 5/23 (22%)
LRR 11 310..332 4/21 (19%)
LRR_8 311..370 CDD:290566 15/58 (26%)
leucine-rich repeat 311..333 CDD:275380 4/21 (19%)
LRR 12 335..358 7/22 (32%)
leucine-rich repeat 336..359 CDD:275380 7/22 (32%)
LRRCT 368..419 CDD:214507 6/12 (50%)
I-set 429..513 CDD:254352
Ig 440..513 CDD:299845
fn3 526..593 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 159 1.000 Inparanoid score I4234
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8753
orthoMCL 1 0.900 - - OOG6_103993
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.