DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caps and LOC100535105

DIOPT Version :9

Sequence 1:NP_001303391.1 Gene:caps / 39493 FlyBaseID:FBgn0023095 Length:811 Species:Drosophila melanogaster
Sequence 2:XP_009298331.1 Gene:LOC100535105 / 100535105 -ID:- Length:706 Species:Danio rerio


Alignment Length:398 Identity:105/398 - (26%)
Similarity:174/398 - (43%) Gaps:44/398 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LCLCLVLATLPVAL-GLANCPNGCECD-----------DDTLMVNCGEGTLDVLPIALNPAIQRL 77
            |.:.|.:||..:|. ...:||..|.|:           .:...::|.:..|..||..|....|.|
Zfish    10 LLVGLAMATFVIAAEEKISCPKLCVCEIRPWFSPSSVYMEAPTIDCNDLGLFKLPTRLPLDTQVL 74

  Fly    78 VIKNNKLKTIDSSMQFYAQLTFLDLSFNDMLTIPERSFAYHAKLQELHLDHNKIGQVSNKTFLGL 142
            :::.|.:...:..:.:...:|.:|||.|::.:|.:.:.....:|..||::.              
Zfish    75 LLQTNNIAKNEHPLDYLTNITEIDLSQNNLSSINDINIGSLPQLLSLHMEE-------------- 125

  Fly   143 STISVLNLRGNLIAELEYRTFSPMVKLAELNLGQNRISHIDPHALDGLDNLRVLYLDDNTLTTVP 207
                      |.|..|...:.|.:..|.||.|..|.||.|.|.|..||.:|..|:|:.|.|..:.
Zfish   126 ----------NWICSLPDNSLSQLTNLQELYLNHNLISLISPEAFRGLQSLLRLHLNSNRLQIIK 180

  Fly   208 GELTFQALHSLAELYLGTNSFMTIPGGAFQDLKGLTRLDLRGAGLHNISGDALKGLVSLRFLDLS 272
            .| .|:.|.:|..|.:|.|..::|....|:.|:.|..|.|....|..|..|:..||.:|..:...
Zfish   181 SE-WFEPLPNLEILMIGENPVLSIQDMNFKPLRNLRSLVLTRMNLSQIPDDSFLGLDNLESISFY 244

  Fly   273 DNRLPAIPTAAFQRLGRLEQLNIGQNDFEVISSGAFSGLRELRHLELTGAQRLRRVESGAFSGNT 337
            ||..|.:|..|.:.|..|:.|::.:|....|..|.|..:..|:.|.:.....|..::|.|.:...
Zfish   245 DNTFPKVPHGALRHLKSLKFLDLNKNPIGRIQRGDFVDMLHLKELGINSMPELVSIDSFALNNLP 309

  Fly   338 NLEHLNLSSNKQLNELSSIALGGLPHLSTVVLKANQLSSLD----EGLVPWADLQTLDLSENPFE 398
            .|..:..::|.:|:.:...|...||.|.|::|..|.||:|.    |.|   .:|:.:.:..||..
Zfish   310 ELTKIEATNNPKLSYIHPNAFYRLPRLETLMLNGNALSALHRITVESL---PNLREVSMHSNPIR 371

  Fly   399 CDCRLLWL 406
            |||.:.|:
Zfish   372 CDCVVRWM 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
capsNP_001303391.1 leucine-rich repeat 75..96 CDD:275380 3/20 (15%)
LRR_8 96..155 CDD:290566 10/58 (17%)
leucine-rich repeat 97..120 CDD:275380 6/22 (27%)
leucine-rich repeat 121..144 CDD:275380 3/22 (14%)
LRR_8 143..201 CDD:290566 19/57 (33%)
leucine-rich repeat 145..168 CDD:275380 4/22 (18%)
LRR_RI 147..397 CDD:238064 74/253 (29%)
leucine-rich repeat 169..192 CDD:275380 12/22 (55%)
leucine-rich repeat 193..217 CDD:275380 8/23 (35%)
LRR_8 217..276 CDD:290566 18/58 (31%)
leucine-rich repeat 218..241 CDD:275380 7/22 (32%)
leucine-rich repeat 242..265 CDD:275380 8/22 (36%)
LRR_8 265..321 CDD:290566 15/55 (27%)
leucine-rich repeat 266..289 CDD:275380 7/22 (32%)
leucine-rich repeat 290..313 CDD:275380 6/22 (27%)
LRR_8 312..374 CDD:290566 15/61 (25%)
leucine-rich repeat 314..335 CDD:275380 5/20 (25%)
leucine-rich repeat 339..363 CDD:275380 5/23 (22%)
LRRCT 395..445 CDD:214507 6/12 (50%)
LOC100535105XP_009298331.1 leucine-rich repeat 52..70 CDD:275380 5/17 (29%)
leucine-rich repeat 71..93 CDD:275380 3/21 (14%)
LRR_RI 88..>273 CDD:238064 58/209 (28%)
leucine-rich repeat 95..117 CDD:275380 6/21 (29%)
LRR_8 116..176 CDD:290566 23/83 (28%)
leucine-rich repeat 118..141 CDD:275380 7/46 (15%)
leucine-rich repeat 142..165 CDD:275380 12/22 (55%)
LRR_8 165..221 CDD:290566 18/56 (32%)
leucine-rich repeat 166..189 CDD:275380 8/23 (35%)
leucine-rich repeat 190..213 CDD:275380 7/22 (32%)
LRR_8 212..272 CDD:290566 18/59 (31%)
leucine-rich repeat 214..237 CDD:275380 8/22 (36%)
leucine-rich repeat 238..261 CDD:275380 7/22 (32%)
leucine-rich repeat 262..285 CDD:275380 6/22 (27%)
leucine-rich repeat 286..310 CDD:275380 5/23 (22%)
LRR_8 309..370 CDD:290566 17/63 (27%)
leucine-rich repeat 311..333 CDD:275380 4/21 (19%)
leucine-rich repeat 336..357 CDD:275380 8/20 (40%)
leucine-rich repeat 360..372 CDD:275378 3/11 (27%)
LRRCT 368..411 CDD:214507 6/12 (50%)
IG_like 429..513 CDD:214653
Ig 437..513 CDD:299845
fn3 518..593 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4248
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6470
orthoMCL 1 0.900 - - OOG6_103993
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.