DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caps and lrrtm1

DIOPT Version :9

Sequence 1:NP_001303391.1 Gene:caps / 39493 FlyBaseID:FBgn0023095 Length:811 Species:Drosophila melanogaster
Sequence 2:XP_002935525.1 Gene:lrrtm1 / 100493874 XenbaseID:XB-GENE-966481 Length:521 Species:Xenopus tropicalis


Alignment Length:404 Identity:102/404 - (25%)
Similarity:157/404 - (38%) Gaps:96/404 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LCLCLCL--------CLVLATLPV---ALGLAN--CPNGCECDDDTLMVNCGEGTLDVLPIALNP 72
            |.:.|||        .|:|.||.|   .|.|.|  ||..|.|:...|.  |....:..:|..|:.
 Frog     4 LLIGLCLNWLLRKPPGLILCTLGVFVKMLPLVNSGCPRLCRCEGRFLY--CESQNVTEIPHNLSG 66

  Fly    73 AIQRLVIKNNKLKTIDSSMQFYAQLTFLDLSFNDMLTIPERSFAYHAKLQELHLDHNKIGQVSNK 137
            .:.                        |.|.:|.:..:.:..|....:|..|:||||.|..|...
 Frog    67 VMG------------------------LSLRYNSLSELQDGQFTGLIQLTWLYLDHNHIHTVEGN 107

  Fly   138 TFLGLSTISVLNLRGNLIAELEYRTFSPMVKLAELNLGQNRISHIDPHALDGLDNLRVLYLDDNT 202
            .|..|..:..|.|..|.|..|...||.||                        .|||.:.|.:|.
 Frog   108 AFHKLRRVKELTLSSNKITHLANTTFRPM------------------------PNLRSVDLSNNN 148

  Fly   203 LTTVPGELTFQALHSLAELYLGTNSFMTIPGGAFQDLKGLTRLDLRGAGLHNISGDALKGLVSLR 267
            |.::..:| |..|..|..|::..|:...:|...|||.:                        ||:
 Frog   149 LQSLEADL-FHGLRKLTTLHMRYNAIKFVPVRIFQDCR------------------------SLK 188

  Fly   268 FLDLSDNRLPAIPTAAFQRLGRLEQLNIGQNDFEVISSGAFSGLRELRHLELTGAQRLRRVESGA 332
            ||||..|:|.::...:|..|.:|.:|::..||...::...|..|..|..|.:...:....|.|..
 Frog   189 FLDLGYNQLKSLARNSFAGLFKLTELHLEHNDLVKVNLAHFPRLLSLHSLFMRRNKVTIVVNSLD 253

  Fly   333 FSGNTNLEHLNLSSNKQLNELSSIALGGLPHLSTVVLKANQLSSLDEGLV-PWADLQTLDLSENP 396
            |.  ..||.::||.| ::..:.......||||.::.|.:|:|:.:|..:: .|..|.::.|:.|.
 Frog   254 FV--WKLEKMDLSGN-EIEYIEPHVFESLPHLESLQLDSNRLTYVDPRILNSWKSLSSITLAGNN 315

  Fly   397 FECD---CRLL-WL 406
            ::|.   |.|. ||
 Frog   316 WDCGRNVCALASWL 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
capsNP_001303391.1 leucine-rich repeat 75..96 CDD:275380 0/20 (0%)
LRR_8 96..155 CDD:290566 17/58 (29%)
leucine-rich repeat 97..120 CDD:275380 4/22 (18%)
leucine-rich repeat 121..144 CDD:275380 10/22 (45%)
LRR_8 143..201 CDD:290566 13/57 (23%)
leucine-rich repeat 145..168 CDD:275380 9/22 (41%)
LRR_RI 147..397 CDD:238064 63/250 (25%)
leucine-rich repeat 169..192 CDD:275380 0/22 (0%)
leucine-rich repeat 193..217 CDD:275380 8/23 (35%)
LRR_8 217..276 CDD:290566 14/58 (24%)
leucine-rich repeat 218..241 CDD:275380 7/22 (32%)
leucine-rich repeat 242..265 CDD:275380 0/22 (0%)
LRR_8 265..321 CDD:290566 18/55 (33%)
leucine-rich repeat 266..289 CDD:275380 9/22 (41%)
leucine-rich repeat 290..313 CDD:275380 6/22 (27%)
LRR_8 312..374 CDD:290566 16/61 (26%)
leucine-rich repeat 314..335 CDD:275380 5/20 (25%)
leucine-rich repeat 339..363 CDD:275380 6/23 (26%)
LRRCT 395..445 CDD:214507 6/16 (38%)
lrrtm1XP_002935525.1 LRRNT 38..>61 CDD:214470 6/24 (25%)
LRR 53..>316 CDD:227223 79/338 (23%)
leucine-rich repeat 70..90 CDD:275380 4/19 (21%)
leucine-rich repeat 91..114 CDD:275380 10/22 (45%)
LRR_8 114..173 CDD:338972 21/83 (25%)
leucine-rich repeat 115..138 CDD:275380 9/46 (20%)
leucine-rich repeat 139..162 CDD:275380 8/23 (35%)
leucine-rich repeat 163..186 CDD:275380 7/46 (15%)
leucine-rich repeat 187..210 CDD:275380 9/22 (41%)
leucine-rich repeat 211..234 CDD:275380 6/22 (27%)
leucine-rich repeat 235..257 CDD:275380 5/23 (22%)
leucine-rich repeat 258..281 CDD:275380 6/23 (26%)
leucine-rich repeat 282..300 CDD:275380 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.