DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caps and lrrc4

DIOPT Version :9

Sequence 1:NP_001303391.1 Gene:caps / 39493 FlyBaseID:FBgn0023095 Length:811 Species:Drosophila melanogaster
Sequence 2:XP_002939414.1 Gene:lrrc4 / 100493671 XenbaseID:XB-GENE-968937 Length:641 Species:Xenopus tropicalis


Alignment Length:334 Identity:108/334 - (32%)
Similarity:151/334 - (45%) Gaps:63/334 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 LNLRGNLIAELEYRTFSPMVKLAELNLGQNRISHIDPHALDGLDNLRVLYLDDNTLTTVPGELTF 212
            |||..|.|..::..||..:..|..|.||:|.|..|:..|.:||.:|..|.|.||.||.:|.. .|
 Frog    74 LNLMENNIQMIQADTFRHLHHLEVLQLGRNSIRQIEVGAFNGLASLNTLELFDNWLTVIPSG-AF 137

  Fly   213 QALHSLAELYLGTNSFMTIPGGAFQDLKGLTRLDLRGAG----LHNISGDALKGLVSLRFLDLSD 273
            :.|..|.||:|..|...:||..||..:..|.||||   |    |..||..|.:||.:|::|:|..
 Frog   138 EYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDL---GELKKLEYISEGAFEGLYNLKYLNLGM 199

  Fly   274 NRLPAIPTAAFQRLGRLEQLNIGQNDFEVISSGAFSGLRELRHLELTGAQRLRRVESGAFSGNTN 338
            ..:..:|.  ...|..||:|.|..|:|..|..|:|.|||.|:.|.:..:| :..:|..||...|:
 Frog   200 CNIRDMPN--LTPLVGLEELEISGNNFPEIKPGSFHGLRSLKKLWIMNSQ-INTIERNAFDDLTS 261

  Fly   339 LEHLNLSSNKQLNELSSIALGGLPHLSTVVLKANQLSSLDEGLVPWADLQTLDLSENPFECDCRL 403
            |..|||:.|.         :..|||               :...|...|..|.|..||::|||.:
 Frog   262 LVELNLAHNN---------VTSLPH---------------DLFAPLKYLVELHLHHNPWDCDCDV 302

  Fly   404 LWLRHLL---VSRNAS------------GQYAPVI------CAYP---TALRDLPLA--HLAEPL 442
            |||...|   :..|::            |:|...:      |:.|   .|.|||.::  .:||  
 Frog   303 LWLSWWLREYIPTNSTCCGRCHSPPHMRGKYVVEVDHSMFQCSAPFIMDAPRDLNISEGRMAE-- 365

  Fly   443 LGCAHGAAS 451
            |.|...|.|
 Frog   366 LKCRTSAMS 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
capsNP_001303391.1 leucine-rich repeat 75..96 CDD:275380
LRR_8 96..155 CDD:290566 4/6 (67%)
leucine-rich repeat 97..120 CDD:275380
leucine-rich repeat 121..144 CDD:275380
LRR_8 143..201 CDD:290566 20/52 (38%)
leucine-rich repeat 145..168 CDD:275380 7/19 (37%)
LRR_RI 147..397 CDD:238064 85/252 (34%)
leucine-rich repeat 169..192 CDD:275380 10/22 (45%)
leucine-rich repeat 193..217 CDD:275380 10/23 (43%)
LRR_8 217..276 CDD:290566 24/62 (39%)
leucine-rich repeat 218..241 CDD:275380 9/22 (41%)
leucine-rich repeat 242..265 CDD:275380 12/26 (46%)
LRR_8 265..321 CDD:290566 19/55 (35%)
leucine-rich repeat 266..289 CDD:275380 5/22 (23%)
leucine-rich repeat 290..313 CDD:275380 11/22 (50%)
LRR_8 312..374 CDD:290566 16/61 (26%)
leucine-rich repeat 314..335 CDD:275380 6/20 (30%)
leucine-rich repeat 339..363 CDD:275380 6/23 (26%)
LRRCT 395..445 CDD:214507 21/75 (28%)
lrrc4XP_002939414.1 LRRNT 40..71 CDD:214470
LRR <68..285 CDD:227223 81/241 (34%)
leucine-rich repeat 71..94 CDD:275380 7/19 (37%)
leucine-rich repeat 95..118 CDD:275380 10/22 (45%)
leucine-rich repeat 119..142 CDD:275380 10/23 (43%)
leucine-rich repeat 143..166 CDD:275380 9/22 (41%)
leucine-rich repeat 167..191 CDD:275380 12/26 (46%)
leucine-rich repeat 192..213 CDD:275380 5/22 (23%)
leucine-rich repeat 214..237 CDD:275380 11/22 (50%)
leucine-rich repeat 238..261 CDD:275380 6/23 (26%)
leucine-rich repeat 262..283 CDD:275380 8/44 (18%)
LRRCT 294..345 CDD:214507 12/50 (24%)
IG_like 353..435 CDD:214653 9/24 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9420
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.