DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caps and lrrtm4l1

DIOPT Version :9

Sequence 1:NP_001303391.1 Gene:caps / 39493 FlyBaseID:FBgn0023095 Length:811 Species:Drosophila melanogaster
Sequence 2:NP_001373591.1 Gene:lrrtm4l1 / 100000724 ZFINID:ZDB-GENE-080327-15 Length:571 Species:Danio rerio


Alignment Length:534 Identity:128/534 - (23%)
Similarity:205/534 - (38%) Gaps:141/534 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LCLCLVLATLPVALGLANCPNGCECDDDTLMVNCGEGTLDVLPIALNPAIQRLVIKNNKLKTIDS 89
            |.|....:.|..:.|...||..|.|:..  :|:|.......:|..::.:.|.             
Zfish    13 LLLLQASSLLLFSSGERMCPYSCHCEGK--IVHCESSAFQDVPENISVSCQG------------- 62

  Fly    90 SMQFYAQLTFLDLSFNDMLTIPERSFAYHAKLQELHLDHNKIGQVSNKTFLGLSTISVLNLRGNL 154
                      |.|.:||:.|:....||:..:|..|:||||:|..|.::.|.|:.           
Zfish    63 ----------LSLRYNDLHTMLPYQFAHLNQLLWLYLDHNQIMFVDSRAFQGVR----------- 106

  Fly   155 IAELEYRTFSPMVKLAELNLGQNRISHIDPHALDGLDNLRVLYLDDNTLTTV-PGELTFQALHSL 218
                         :|.||.|..||||.:......|:.|||.|.|..|.|..: ||:  |..|..|
Zfish   107 -------------RLKELILSSNRISQLHNVTFHGVPNLRSLDLSYNKLQELQPGQ--FYGLRKL 156

  Fly   219 AELYLGTNSFMTIPGGAFQDLKGLTRLDLRGAGLHNISGDALKGLVSLRFLDLSDNRLPAIPTAA 283
            ..|:|.:|....||..||.:.:                        ||.||||..|||..:...|
Zfish   157 QNLHLRSNGLTAIPVRAFLECR------------------------SLEFLDLGYNRLRVLTRTA 197

  Fly   284 FQRLGRLEQLNIGQNDFEVISSGAFSGLRELRHLELTGAQRLRRVESGAFSGNTNLEHLNLSSNK 348
            |..|.||.:|::..|.|..|:...|..|..||.|.|.. .|:|.|..|.......|:.|::|.| 
Zfish   198 FLGLSRLMELHLEHNQFSRINFFLFPRLANLRALYLQW-NRIRAVNQGLPWSWYTLQRLDISGN- 260

  Fly   349 QLNELSSIALGGLPHLSTVVLKANQLSSLDEGLV-PWADLQTLDLSENPFECD---CRL-LWLRH 408
            ::..|..:....||:|..:.|::|:|:::.:.:| .|..|.|:.|:.|.::|.   |.| :||::
Zfish   261 EIQVLDPVVFQCLPNLQVLNLESNKLANVSQEVVAAWISLTTISLAGNMWDCGPGICPLVVWLKN 325

  Fly   409 LLVSRNASGQYAPVICAYPTALRDLPLAHLAEPLLGCAHGAASKQAIIGILVVACAALITTLALV 473
            ...:::.:     :||:.|..|:...:...::..:.|.....:.|:.:                 
Zfish   326 FRGTKDTN-----IICSSPKHLQGEKVIEASKNYIDCDDYEITAQSPL----------------- 368

  Fly   474 LYTCRHRIREMLKGHSALGRKEREYQKTFSDEEYMSRPPPGGGGVHPAAGGYPYIAGNSRMIPVT 538
                                    |.:||.....::..|.           .|.:|..:...|:.
Zfish   369 ------------------------YLQTFDPNYDLALEPT-----------EPTMAPTTPPPPLP 398

  Fly   539 ELXLEAP-PPPQLR 551
            .. .||| ||||.|
Zfish   399 SPASEAPFPPPQPR 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
capsNP_001303391.1 leucine-rich repeat 75..96 CDD:275380 1/20 (5%)
LRR_8 96..155 CDD:290566 17/58 (29%)
leucine-rich repeat 97..120 CDD:275380 7/22 (32%)
leucine-rich repeat 121..144 CDD:275380 10/22 (45%)
LRR_8 143..201 CDD:290566 14/57 (25%)
leucine-rich repeat 145..168 CDD:275380 0/22 (0%)
LRR_RI 147..397 CDD:238064 73/251 (29%)
leucine-rich repeat 169..192 CDD:275380 9/22 (41%)
leucine-rich repeat 193..217 CDD:275380 10/24 (42%)
LRR_8 217..276 CDD:290566 15/58 (26%)
leucine-rich repeat 218..241 CDD:275380 8/22 (36%)
leucine-rich repeat 242..265 CDD:275380 0/22 (0%)
LRR_8 265..321 CDD:290566 24/55 (44%)
leucine-rich repeat 266..289 CDD:275380 11/22 (50%)
leucine-rich repeat 290..313 CDD:275380 7/22 (32%)
LRR_8 312..374 CDD:290566 18/61 (30%)
leucine-rich repeat 314..335 CDD:275380 8/20 (40%)
leucine-rich repeat 339..363 CDD:275380 6/23 (26%)
LRRCT 395..445 CDD:214507 10/53 (19%)
lrrtm4l1NP_001373591.1 leucine-rich repeat 60..83 CDD:275380 8/45 (18%)
LRR_8 63..118 CDD:404697 22/78 (28%)
leucine-rich repeat 84..107 CDD:275380 10/46 (22%)
LRR_8 106..166 CDD:404697 24/85 (28%)
leucine-rich repeat 108..131 CDD:275380 9/22 (41%)
leucine-rich repeat 132..155 CDD:275380 10/24 (42%)
PPP1R42 153..308 CDD:411060 53/180 (29%)
leucine-rich repeat 156..179 CDD:275380 8/46 (17%)
leucine-rich repeat 180..203 CDD:275380 11/22 (50%)
leucine-rich repeat 204..227 CDD:275380 7/22 (32%)
leucine-rich repeat 228..251 CDD:275380 8/23 (35%)
leucine-rich repeat 252..275 CDD:275380 6/23 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.