DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snky and Dcstamp

DIOPT Version :9

Sequence 1:NP_648633.2 Gene:snky / 39492 FlyBaseID:FBgn0086916 Length:715 Species:Drosophila melanogaster
Sequence 2:XP_008763694.1 Gene:Dcstamp / 103690326 RGDID:1310435 Length:470 Species:Rattus norvegicus


Alignment Length:405 Identity:89/405 - (21%)
Similarity:165/405 - (40%) Gaps:78/405 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 LFGNPDKI------------CDPSAVVPQNFGETYVELLKAEKKLFDNSSQIVVNYEIKDEQFAK 347
            :||:.:.|            |:..|   :|| .|:..|||...:..:....:.....:.|:..:.
  Rat   107 IFGHVENIFSNFRGLLDSMTCNLRA---KNF-STHFPLLKRYIEAIEWIYGLTTPLNVLDDLVSW 167

  Fly   348 SQ-----LKSAERTGQAFKEDFERQKRIFNKVMGIL--------------QKILCLFMLRMVYVS 393
            :|     |.|.....||...|..      .:|:.:|              ||:|.|..|.::.||
  Rat   168 NQTLAVSLFSPSHALQAHMNDTR------GEVLSVLHRMVLTTELLTSVGQKLLALAGLLLILVS 226

  Fly   394 INYYVK-YLNDV--EFDNFYITKYFKHVDQRRKEQRIDAILPLRTYEKSKYIDVDHIFSRTHHES 455
            ...::| :|...  :::|.|||:.|...|:..:.|:...:|||...|:.|||.|..: ..|..|.
  Rat   227 TGLFLKRFLGPCGWKYENVYITRQFVLFDEEERCQQRPCVLPLNRKERKKYIIVPSL-KLTPKER 290

  Fly   456 TTVCFNLLQFLLELVTAGLFILIDHLVVELLQIVRKRSKIVYQQDGEHEVRFNISGVGQMARLLR 520
            ..:....|..|..|....||..:|:|:..|:..|.|:    :|.....||...:.|..|..   .
  Rat   291 RNLGLFFLPVLTYLYMWMLFATVDYLLYRLISSVNKQ----FQSLPGLEVHLRLHGEKQGT---H 348

  Fly   521 TTMHN--FNIHEKVSTSLSNKECLPNAHVLPKKMYYQLILLYLIIIVLIYQSTTFLRMRRVICSF 583
            ..:|:  |||      |:....|:....:...:.:..|.::.|.:::|...|:..::::.::...
  Rat   349 GVIHDSAFNI------SMFEPSCILKPRLSVSQTWVPLSIILLTLVILGLLSSMLMQLKILVSVS 407

  Fly   584 FYYKREKQRILFLYNRILRNRLRSLEFLIHDAEDNLATHRIQQQVNVFLWLRFSCPVAFGWIRHF 648
            ||.|.|::||.:|:.::|..|.:.   .:.:|:..|:.:        |..:.|       |:...
  Rat   408 FYPKVERERIEYLHAKLLEKRSKQ---PLGEADRKLSLY--------FKKIHF-------WLPVL 454

  Fly   649 KFAKRTCMICRGLED 663
            |..::..||....:|
  Rat   455 KMTRKKHMIPANEDD 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkyNP_648633.2 DC_STAMP 406..597 CDD:311636 48/192 (25%)
DcstampXP_008763694.1 DC_STAMP 242..421 CDD:285077 48/192 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354354
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.