DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trn and TRIL

DIOPT Version :9

Sequence 1:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_055632.2 Gene:TRIL / 9865 HGNCID:22200 Length:811 Species:Homo sapiens


Alignment Length:767 Identity:177/767 - (23%)
Similarity:275/767 - (35%) Gaps:192/767 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RNMMIAFVGIWCILASIGVEPAAGLANCPPGCQCDDNTLVVQCGEG------------QLDVLPI 55
            |.:.:..|...|:......||.     ||..|.|.....::....|            ..|||..
Human     5 RALRLLLVVCGCLALPPLAEPV-----CPERCDCQHPQHLLCTNRGLRVVPKTSSLPSPHDVLTY 64

  Fly    56 ALNPS---------------IQRLVIKSNKIKTI-DSSIQFYAELTFLDLSSNHLMTIPQRTFAY 104
            :|..:               ::||.::.|:|::: ..:.:..:.|..|.|.:|.|..:...|.|.
Human    65 SLGGNFITNITAFDFHRLGQLRRLDLQYNQIRSLHPKTFEKLSRLEELYLGNNLLQALAPGTLAP 129

  Fly   105 QKKLQEVHLNHNKIGQISNKTFIGLSAVTVLNLRGNQISELHQGTFTPLLKIEELNLGENRIGYL 169
            .:||:.::.|.|:|.::|..:|.||.::..|.|.||.:..|....|.||..:..|:|..|||.:|
Human   130 LRKLRILYANGNEISRLSRGSFEGLESLVKLRLDGNALGALPDAVFAPLGNLLYLHLESNRIRFL 194

  Fly   170 DPKAFDGLSQLRILYLDDNAL-TTVPDPVIFQAMPSLAELFLGMNTLQSIQADAFQDLKGLTRLE 233
            ...||..|.:||.|.|..|.| .::.....|..:.||:.|.|..|.||.:....||.|..|..|.
Human   195 GKNAFAQLGKLRFLNLSANELQPSLRHAATFAPLRSLSSLILSANNLQHLGPRIFQHLPRLGLLS 259

  Fly   234 LKGASLRNISHDSFLGLQELRILDLSDNRLDRIPSVGLSKLVRLEQLSLGQNDFEVISEGAFMGL 298
            |:|..|.:::.::|.||:.||.|.|..|||.::|:..|..|..||.|.|..|:...:....|   
Human   260 LRGNQLTHLAPEAFWGLEALRELRLEGNRLSQLPTALLEPLHSLEALDLSGNELSALHPATF--- 321

  Fly   299 KQLKRLEVNGALRLKRVMTGAFSDNGNLEYLNLSSNKMLLEVQEGALSGLSQLKHVVLKANALTS 363
                                                           ..|.:|:.:.|:.|||::
Human   322 -----------------------------------------------GHLGRLRELSLRNNALSA 339

  Fly   364 LAEGLFPWKD-LQTLDLSENPLSCDCRVMWLHNLLVAKNASQDDVSELL-----CEFPERLRGES 422
            |:..:|.... |..|||..|..:||||:..|...:    ........||     |..|..|||:.
Human   340 LSGDIFAASPALYRLDLDGNGWTCDCRLRGLKRWM----GDWHSQGRLLTVFVQCRHPPALRGKY 400

  Fly   423 LRHL-----------NPAMMGCTHADPRKQALIGALLVGSAATITALALVLYRCRHKIRET---I 473
            |.:|           :|:......||.|:|.|..|  .|...|..|........:.::::.   :
Human   401 LDYLDDQQLQNGSCADPSPSASLTADRRRQPLPTA--AGEEMTPPAGLAEELPPQPQLQQQGRFL 463

  Fly   474 KGGLWGNSA-----------LGRKEREYQKTFCDEDYMSRHQHHPCSLGIHSTFPN----TYTAP 523
            .|..|..:|           |.|:....|:.  .....:.....|.||.:|.. |.    |...|
Human   464 AGVAWDGAARELVGNRSALRLSRRGPGLQQP--SPSVAAAAGPAPQSLDLHKK-PQRGRPTRADP 525

  Fly   524 --HHPGATHHYGMCPMPVNDLGAIDPQQKFQQLVVPTATMISEKKLNNNKALVSQGA------ID 580
              ..|..|...|..|.|     |.||.|:        ||.......:..:|..|.|.      :.
Human   526 ALAEPTPTASPGSAPSP-----AGDPWQR--------ATKHRLGTEHQERAAQSDGGAGLPPLVS 577

  Fly   581 DSASF----VLHMKSATMGRDVHQQNPQLNHYTKPQFLSATATVGDSCYSYADVPMVHGAPLGGP 641
            |...|    :.::....:|.|.......:..:..|:                        |||| 
Human   578 DPCDFNKFILCNLTVEAVGADSASVRWAVREHRSPR------------------------PLGG- 617

  Fly   642 NQPQLRLTQEHFKQRELYDQEMGSEILDHNYIY-SNTHYSMPLEQLGRSKTP 692
              .:.||..:.|.|:..:          |.::| ..:..|..|.:| |..||
Human   618 --ARFRLLFDRFGQQPKF----------HRFVYLPESSDSATLREL-RGDTP 656

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380 4/18 (22%)
LRR_8 83..142 CDD:290566 20/58 (34%)
leucine-rich repeat 84..107 CDD:275380 7/22 (32%)
leucine-rich repeat 108..131 CDD:275380 8/22 (36%)
LRR_RI 129..421 CDD:238064 83/298 (28%)
LRR_8 132..190 CDD:290566 22/57 (39%)
leucine-rich repeat 132..155 CDD:275380 8/22 (36%)
leucine-rich repeat 156..179 CDD:275380 9/22 (41%)
leucine-rich repeat 180..204 CDD:275380 7/24 (29%)
LRR_8 203..263 CDD:290566 23/59 (39%)
leucine-rich repeat 205..228 CDD:275380 9/22 (41%)
leucine-rich repeat 229..252 CDD:275380 8/22 (36%)
LRR_8 252..308 CDD:290566 16/55 (29%)
leucine-rich repeat 253..276 CDD:275380 10/22 (45%)
leucine-rich repeat 277..300 CDD:275380 6/22 (27%)
leucine-rich repeat 301..322 CDD:275380 0/20 (0%)
LRR_8 325..384 CDD:290566 13/59 (22%)
leucine-rich repeat 326..350 CDD:275380 1/23 (4%)
leucine-rich repeat 351..373 CDD:275380 7/21 (33%)
TRILNP_055632.2 LRR_RI <2..194 CDD:238064 47/193 (24%)
leucine-rich repeat 37..61 CDD:275380 1/23 (4%)
LRR 1 61..81 3/19 (16%)
leucine-rich repeat 62..84 CDD:275380 2/21 (10%)
LRR_8 84..143 CDD:290566 15/58 (26%)
LRR 2 84..105 4/20 (20%)
leucine-rich repeat 85..108 CDD:275380 4/22 (18%)
LRR 3 108..129 6/20 (30%)
leucine-rich repeat 109..132 CDD:275380 7/22 (32%)
LRR 4 132..153 7/20 (35%)
leucine-rich repeat 133..156 CDD:275380 8/22 (36%)
LRR_8 156..215 CDD:290566 22/58 (38%)
LRR 5 156..177 6/20 (30%)
leucine-rich repeat 157..180 CDD:275380 8/22 (36%)
LRR 6 180..201 8/20 (40%)
leucine-rich repeat 181..204 CDD:275380 9/22 (41%)
LRR 7 204..223 6/18 (33%)
leucine-rich repeat 205..254 CDD:275380 17/48 (35%)
LRR 8 230..251 8/20 (40%)
LRR_8 239..289 CDD:290566 19/49 (39%)
LRR_RI <249..>364 CDD:238064 40/164 (24%)
LRR 9 254..275 6/20 (30%)
leucine-rich repeat 255..278 CDD:275380 8/22 (36%)
LRR 10 278..299 9/20 (45%)
LRR_8 279..337 CDD:290566 20/107 (19%)
leucine-rich repeat 279..302 CDD:275380 10/22 (45%)
LRR 11 302..323 6/70 (9%)
leucine-rich repeat 303..326 CDD:275380 7/72 (10%)
LRR 12 326..347 7/20 (35%)
leucine-rich repeat 327..346 CDD:275380 6/18 (33%)
leucine-rich repeat 351..363 CDD:275378 5/11 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 484..549 18/72 (25%)
fn3 589..667 CDD:278470 19/106 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.