DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trn and Lrrc17

DIOPT Version :9

Sequence 1:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_083253.1 Gene:Lrrc17 / 74511 MGIID:1921761 Length:443 Species:Mus musculus


Alignment Length:430 Identity:104/430 - (24%)
Similarity:159/430 - (36%) Gaps:128/430 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PGCQCDDNTLV----VQCGEGQL-DVLPIALNPSIQRLVIKSNKIKTIDSSIQFYAELTFLDLSS 91
            ||..||..|.:    :.|.|.:| .|||                        .:..:|..:.|:.
Mouse    52 PGLPCDVYTYLHEKYLDCQERKLVYVLP------------------------DWPQDLLHMLLAR 92

  Fly    92 NHLMTIPQRTFAYQKKLQEVHLNHNKIGQISNKTFIGLSAVTVLNLRGNQISELHQGTF--TPLL 154
            |.:..:....||..|:|:.:.|..|:|.:|.::.|.||:.:|.|.|:.|||..|.:..|  ||||
Mouse    93 NKIRVLKNNMFAKFKRLKSLDLQQNEISKIESEAFFGLNKLTTLLLQHNQIKVLTEEAFIYTPLL 157

  Fly   155 K------------------IEELNLGENR-IG-YLDPKAFDGLSQLRILYLDDNALTTV------ 193
            .                  |..|.:..|| :| |....:...|...::|.|....|...      
Mouse   158 SYLRLYDNPWHCTCELETLISMLQIPRNRNLGNYAKCGSPPALRNKKLLQLKPQELCDEEEKEQL 222

  Fly   194 -PDPVIFQAMPSL----AELFLGMNTLQSIQADAFQDLKGLTRLELKGASLRNISHDSFLGLQEL 253
             |.|.: ..:|::    |:..|..|.:..||.   .|.|   |.|||... .||..|       :
Mouse   223 DPKPQV-SGIPAVIRPEADSTLCHNYVFPIQT---LDCK---RKELKKVP-SNIPPD-------I 272

  Fly   254 RILDLSDNRLDRIPSVGLSKLVRLEQLSLGQNDFEVISEGAFMGLKQLKRLEVNGALRLKRVMTG 318
            ..||||.|::.::.......:..|::|:|..|..|.|...||:||..|:.|::            
Mouse   273 VKLDLSSNKIRQLRPKEFEDVHELKKLNLSSNGIEFIDPAAFLGLIHLEELDL------------ 325

  Fly   319 AFSDNGNLEYLNLSSNKMLLEVQEGALSGLSQLKHVVLKANALTSLAEGLFPWKDLQTLDLSENP 383
                          ||..|.....|.|..|..||.:.|:.|          ||:           
Mouse   326 --------------SNNSLQNFDYGVLEDLYFLKLLWLRDN----------PWR----------- 355

  Fly   384 LSCDCRVMWLHNLLVAKNASQDDVSELLCEFPERLRGESL 423
              ||..:.:|:..|  |:......:.|.|:.||..:|.|:
Mouse   356 --CDYSIHYLYYWL--KHHYNVHYNGLECKTPEEYKGWSV 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380 0/17 (0%)
LRR_8 83..142 CDD:290566 18/58 (31%)
leucine-rich repeat 84..107 CDD:275380 5/22 (23%)
leucine-rich repeat 108..131 CDD:275380 8/22 (36%)
LRR_RI 129..421 CDD:238064 78/324 (24%)
LRR_8 132..190 CDD:290566 21/79 (27%)
leucine-rich repeat 132..155 CDD:275380 11/24 (46%)
leucine-rich repeat 156..179 CDD:275380 7/24 (29%)
leucine-rich repeat 180..204 CDD:275380 5/30 (17%)
LRR_8 203..263 CDD:290566 20/63 (32%)
leucine-rich repeat 205..228 CDD:275380 6/26 (23%)
leucine-rich repeat 229..252 CDD:275380 7/22 (32%)
LRR_8 252..308 CDD:290566 17/55 (31%)
leucine-rich repeat 253..276 CDD:275380 5/22 (23%)
leucine-rich repeat 277..300 CDD:275380 10/22 (45%)
leucine-rich repeat 301..322 CDD:275380 2/20 (10%)
LRR_8 325..384 CDD:290566 12/58 (21%)
leucine-rich repeat 326..350 CDD:275380 6/23 (26%)
leucine-rich repeat 351..373 CDD:275380 6/21 (29%)
Lrrc17NP_083253.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..48
leucine-rich repeat 65..83 CDD:275380 6/41 (15%)
LRR 1 84..105 4/20 (20%)
leucine-rich repeat 85..108 CDD:275380 5/22 (23%)
LRR_8 86..143 CDD:290566 17/56 (30%)
LRR_4 107..148 CDD:289563 16/40 (40%)
LRR 2 108..129 6/20 (30%)
leucine-rich repeat 109..132 CDD:275380 8/22 (36%)
LRR 3 132..153 8/20 (40%)
leucine-rich repeat 133..156 CDD:275380 9/22 (41%)
leucine-rich repeat 157..207 CDD:275380 8/49 (16%)
TPKR_C2 165..>201 CDD:301599 6/35 (17%)
leucine-rich repeat 208..245 CDD:275380 7/37 (19%)
leucine-rich repeat 251..271 CDD:275380 10/26 (38%)
LRR_RI <270..352 CDD:238064 27/114 (24%)
LRR 4 271..292 6/27 (22%)
leucine-rich repeat 272..295 CDD:275380 5/22 (23%)
LRR_8 274..330 CDD:290566 19/81 (23%)
LRR 5 295..316 8/20 (40%)
LRR_4 296..334 CDD:289563 15/63 (24%)
leucine-rich repeat 296..319 CDD:275380 10/22 (45%)
LRR 6 319..342 7/48 (15%)
leucine-rich repeat 320..343 CDD:275380 8/48 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.