Sequence 1: | NP_001261796.1 | Gene: | trn / 39491 | FlyBaseID: | FBgn0010452 | Length: | 751 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_003256.1 | Gene: | TLR3 / 7098 | HGNCID: | 11849 | Length: | 904 | Species: | Homo sapiens |
Alignment Length: | 524 | Identity: | 128/524 - (24%) |
---|---|---|---|
Similarity: | 203/524 - (38%) | Gaps: | 153/524 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 PGCQCDDNTLV------VQCGEGQLDVLPIAL-NPSIQRLVIKSNKIKTIDSSIQF----YAELT 85
Fly 86 FLDLSSNHLMTIPQRTFAYQKKLQEVHLNHNKIGQ------------------------------ 120
Fly 121 -----------------------------------------------------ISNKTFIGL--S 130
Fly 131 AVTVLNLRGNQISELHQGTFTPLLKIEELNLGENRIGY-LDPKAFDGLSQLRILYLDDN---ALT 191
Fly 192 TVPDPVIFQAMPSLAELFLGMNTLQSIQA--DAFQDLKGLTRLELKGASLRNISHDSFLGLQELR 254
Fly 255 ILDLSDNRLDRI--------PSVGLSKLVRLEQLSLGQNDFEVISEGAFMGLKQLKRLEVNGALR 311
Fly 312 LKRVMTGAFSDNGNLEYLNLSSNKMLLEVQEGALSGLSQLKHVVLKANALTSLAEGLF--PWKDL 374
Fly 375 QTLDLSENPLSCDCR-VMWLHNLLVAKNASQDDVSEL----LCEFPERLRGESLRHLNPAMMGCT 434
Fly 435 HADP 438 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
trn | NP_001261796.1 | leucine-rich repeat | 62..80 | CDD:275380 | 3/17 (18%) |
LRR_8 | 83..142 | CDD:290566 | 23/143 (16%) | ||
leucine-rich repeat | 84..107 | CDD:275380 | 10/22 (45%) | ||
leucine-rich repeat | 108..131 | CDD:275380 | 8/107 (7%) | ||
LRR_RI | 129..421 | CDD:238064 | 91/314 (29%) | ||
LRR_8 | 132..190 | CDD:290566 | 21/61 (34%) | ||
leucine-rich repeat | 132..155 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 156..179 | CDD:275380 | 10/23 (43%) | ||
leucine-rich repeat | 180..204 | CDD:275380 | 6/26 (23%) | ||
LRR_8 | 203..263 | CDD:290566 | 24/61 (39%) | ||
leucine-rich repeat | 205..228 | CDD:275380 | 7/24 (29%) | ||
leucine-rich repeat | 229..252 | CDD:275380 | 9/22 (41%) | ||
LRR_8 | 252..308 | CDD:290566 | 21/63 (33%) | ||
leucine-rich repeat | 253..276 | CDD:275380 | 11/30 (37%) | ||
leucine-rich repeat | 277..300 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 301..322 | CDD:275380 | 5/20 (25%) | ||
LRR_8 | 325..384 | CDD:290566 | 12/60 (20%) | ||
leucine-rich repeat | 326..350 | CDD:275380 | 3/23 (13%) | ||
leucine-rich repeat | 351..373 | CDD:275380 | 5/23 (22%) | ||
TLR3 | NP_003256.1 | LRRNT | 28..50 | CDD:396168 | |
leucine-rich repeat | 33..52 | CDD:275380 | |||
LRR 1 | 52..73 | ||||
leucine-rich repeat | 53..76 | CDD:275380 | |||
PLN00113 | 72..>542 | CDD:215061 | 83/332 (25%) | ||
LRR 2 | 76..97 | ||||
leucine-rich repeat | 77..100 | CDD:275380 | |||
LRR 3 | 100..121 | ||||
leucine-rich repeat | 101..124 | CDD:275380 | |||
LRR 4 | 124..145 | ||||
leucine-rich repeat | 125..148 | CDD:275380 | |||
LRR 5 | 148..168 | ||||
leucine-rich repeat | 149..198 | CDD:275380 | |||
LRR 6 | 172..193 | ||||
LRR 7 | 198..219 | 3/4 (75%) | |||
leucine-rich repeat | 199..249 | CDD:275380 | 10/34 (29%) | ||
LRR 8 | 222..244 | 5/21 (24%) | |||
LRR 9 | 249..270 | 6/21 (29%) | |||
leucine-rich repeat | 250..275 | CDD:275380 | 5/25 (20%) | ||
LRR 10 | 275..296 | 9/20 (45%) | |||
leucine-rich repeat | 276..299 | CDD:275380 | 10/22 (45%) | ||
LRR 11 | 299..320 | 4/20 (20%) | |||
leucine-rich repeat | 300..321 | CDD:275380 | 4/20 (20%) | ||
LRR 12 | 323..344 | 0/20 (0%) | |||
LRR 13 | 356..377 | 0/20 (0%) | |||
leucine-rich repeat | 357..380 | CDD:275380 | 0/22 (0%) | ||
LRR 14 | 380..400 | 1/19 (5%) | |||
leucine-rich repeat | 381..406 | CDD:275380 | 4/24 (17%) | ||
LRR 15 | 408..429 | 7/20 (35%) | |||
leucine-rich repeat | 409..432 | CDD:275380 | 8/22 (36%) | ||
LRR 16 | 432..454 | 8/21 (38%) | |||
leucine-rich repeat | 433..457 | CDD:275380 | 10/23 (43%) | ||
leucine-rich repeat | 458..481 | CDD:275380 | 6/26 (23%) | ||
LRR 17 | 465..486 | 7/24 (29%) | |||
leucine-rich repeat | 482..507 | CDD:275380 | 7/24 (29%) | ||
LRR 18 | 507..528 | 7/20 (35%) | |||
leucine-rich repeat | 508..531 | CDD:275380 | 9/22 (41%) | ||
LRR 19 | 531..552 | 8/20 (40%) | |||
leucine-rich repeat | 532..563 | CDD:275380 | 11/30 (37%) | ||
LRR_8 | 562..622 | CDD:404697 | 18/85 (21%) | ||
LRR 20 | 563..584 | 7/20 (35%) | |||
leucine-rich repeat | 564..585 | CDD:275380 | 7/20 (35%) | ||
LRR 21 | 587..608 | 5/21 (24%) | |||
leucine-rich repeat | 588..611 | CDD:275380 | 5/23 (22%) | ||
LRR 22 | 611..632 | 8/45 (18%) | |||
leucine-rich repeat | 612..630 | CDD:275380 | 7/42 (17%) | ||
leucine-rich repeat | 637..659 | CDD:275380 | 8/21 (38%) | ||
LRRCT | 645..697 | CDD:214507 | 14/56 (25%) | ||
Tlr3_TMD | 698..730 | CDD:407816 | 1/4 (25%) | ||
TIR | 755..900 | CDD:214587 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24373 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |