DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trn and TLR3

DIOPT Version :9

Sequence 1:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_003256.1 Gene:TLR3 / 7098 HGNCID:11849 Length:904 Species:Homo sapiens


Alignment Length:524 Identity:128/524 - (24%)
Similarity:203/524 - (38%) Gaps:153/524 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PGCQCDDNTLV------VQCGEGQLDVLPIAL-NPSIQRLVIKSNKIKTIDSSIQF----YAELT 85
            |||......|.      ||.|....:.|.:.| |.||:.|.:.::::.| .|:..|    :..||
Human   214 PGCFHAIGRLFGLFLNNVQLGPSLTEKLCLELANTSIRNLSLSNSQLST-TSNTTFLGLKWTNLT 277

  Fly    86 FLDLSSNHLMTIPQRTFAYQKKLQEVHLNHNKIGQ------------------------------ 120
            .||||.|:|..:...:||:..:|:...|.:|.|..                              
Human   278 MLDLSYNNLNVVGNDSFAWLPQLEYFFLEYNNIQHLFSHSLHGLFNVRYLNLKRSFTKQSISLAS 342

  Fly   121 -----------------------------------------------------ISNKTFIGL--S 130
                                                                 ::|:||:.|  |
Human   343 LPKIDDFSFQWLKCLEHLNMEDNDIPGIKSNMFTGLINLKYLSLSNSFTSLRTLTNETFVSLAHS 407

  Fly   131 AVTVLNLRGNQISELHQGTFTPLLKIEELNLGENRIGY-LDPKAFDGLSQLRILYLDDN---ALT 191
            .:.:|||..|:||::....|:.|..:|.|:||.|.||. |..:.:.||..:..:||..|   .||
Human   408 PLHILNLTKNKISKIESDAFSWLGHLEVLDLGLNEIGQELTGQEWRGLENIFEIYLSYNKYLQLT 472

  Fly   192 TVPDPVIFQAMPSLAELFLGMNTLQSIQA--DAFQDLKGLTRLELKGASLRNISHDSFLGLQELR 254
            ...    |..:|||..|.|....|:::.:  ..||.|:.||.|:|...::.||:.|...||::|.
Human   473 RNS----FALVPSLQRLMLRRVALKNVDSSPSPFQPLRNLTILDLSNNNIANINDDMLEGLEKLE 533

  Fly   255 ILDLSDNRLDRI--------PSVGLSKLVRLEQLSLGQNDFEVISEGAFMGLKQLKRLEVNGALR 311
            ||||..|.|.|:        |...|..|..|..|:|..|.|:.|....|..|.:||.::: |...
Human   534 ILDLQHNNLARLWKHANPGGPIYFLKGLSHLHILNLESNGFDEIPVEVFKDLFELKIIDL-GLNN 597

  Fly   312 LKRVMTGAFSDNGNLEYLNLSSNKMLLEVQEGALSGLSQLKHVVLKANALTSLAEGLF--PWKDL 374
            |..:....|::..:|:.||                         |:.|.:||:.:.:|  .:::|
Human   598 LNTLPASVFNNQVSLKSLN-------------------------LQKNLITSVEKKVFGPAFRNL 637

  Fly   375 QTLDLSENPLSCDCR-VMWLHNLLVAKNASQDDVSEL----LCEFPERLRGESLRHLNPAMMGCT 434
            ..||:..||..|.|. :.|..|.:   |.:..::.||    ||..|....|..:|..:.:  .|.
Human   638 TELDMRFNPFDCTCESIAWFVNWI---NETHTNIPELSSHYLCNTPPHYHGFPVRLFDTS--SCK 697

  Fly   435 HADP 438
            .:.|
Human   698 DSAP 701

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380 3/17 (18%)
LRR_8 83..142 CDD:290566 23/143 (16%)
leucine-rich repeat 84..107 CDD:275380 10/22 (45%)
leucine-rich repeat 108..131 CDD:275380 8/107 (7%)
LRR_RI 129..421 CDD:238064 91/314 (29%)
LRR_8 132..190 CDD:290566 21/61 (34%)
leucine-rich repeat 132..155 CDD:275380 8/22 (36%)
leucine-rich repeat 156..179 CDD:275380 10/23 (43%)
leucine-rich repeat 180..204 CDD:275380 6/26 (23%)
LRR_8 203..263 CDD:290566 24/61 (39%)
leucine-rich repeat 205..228 CDD:275380 7/24 (29%)
leucine-rich repeat 229..252 CDD:275380 9/22 (41%)
LRR_8 252..308 CDD:290566 21/63 (33%)
leucine-rich repeat 253..276 CDD:275380 11/30 (37%)
leucine-rich repeat 277..300 CDD:275380 8/22 (36%)
leucine-rich repeat 301..322 CDD:275380 5/20 (25%)
LRR_8 325..384 CDD:290566 12/60 (20%)
leucine-rich repeat 326..350 CDD:275380 3/23 (13%)
leucine-rich repeat 351..373 CDD:275380 5/23 (22%)
TLR3NP_003256.1 LRRNT 28..50 CDD:396168
leucine-rich repeat 33..52 CDD:275380
LRR 1 52..73
leucine-rich repeat 53..76 CDD:275380
PLN00113 72..>542 CDD:215061 83/332 (25%)
LRR 2 76..97
leucine-rich repeat 77..100 CDD:275380
LRR 3 100..121
leucine-rich repeat 101..124 CDD:275380
LRR 4 124..145
leucine-rich repeat 125..148 CDD:275380
LRR 5 148..168
leucine-rich repeat 149..198 CDD:275380
LRR 6 172..193
LRR 7 198..219 3/4 (75%)
leucine-rich repeat 199..249 CDD:275380 10/34 (29%)
LRR 8 222..244 5/21 (24%)
LRR 9 249..270 6/21 (29%)
leucine-rich repeat 250..275 CDD:275380 5/25 (20%)
LRR 10 275..296 9/20 (45%)
leucine-rich repeat 276..299 CDD:275380 10/22 (45%)
LRR 11 299..320 4/20 (20%)
leucine-rich repeat 300..321 CDD:275380 4/20 (20%)
LRR 12 323..344 0/20 (0%)
LRR 13 356..377 0/20 (0%)
leucine-rich repeat 357..380 CDD:275380 0/22 (0%)
LRR 14 380..400 1/19 (5%)
leucine-rich repeat 381..406 CDD:275380 4/24 (17%)
LRR 15 408..429 7/20 (35%)
leucine-rich repeat 409..432 CDD:275380 8/22 (36%)
LRR 16 432..454 8/21 (38%)
leucine-rich repeat 433..457 CDD:275380 10/23 (43%)
leucine-rich repeat 458..481 CDD:275380 6/26 (23%)
LRR 17 465..486 7/24 (29%)
leucine-rich repeat 482..507 CDD:275380 7/24 (29%)
LRR 18 507..528 7/20 (35%)
leucine-rich repeat 508..531 CDD:275380 9/22 (41%)
LRR 19 531..552 8/20 (40%)
leucine-rich repeat 532..563 CDD:275380 11/30 (37%)
LRR_8 562..622 CDD:404697 18/85 (21%)
LRR 20 563..584 7/20 (35%)
leucine-rich repeat 564..585 CDD:275380 7/20 (35%)
LRR 21 587..608 5/21 (24%)
leucine-rich repeat 588..611 CDD:275380 5/23 (22%)
LRR 22 611..632 8/45 (18%)
leucine-rich repeat 612..630 CDD:275380 7/42 (17%)
leucine-rich repeat 637..659 CDD:275380 8/21 (38%)
LRRCT 645..697 CDD:214507 14/56 (25%)
Tlr3_TMD 698..730 CDD:407816 1/4 (25%)
TIR 755..900 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.