DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trn and LINGO3

DIOPT Version :9

Sequence 1:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001094861.1 Gene:LINGO3 / 645191 HGNCID:21206 Length:592 Species:Homo sapiens


Alignment Length:490 Identity:124/490 - (25%)
Similarity:194/490 - (39%) Gaps:99/490 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 WCILASI------GVEPAAGLANCPPGCQCDDNTLVVQCGEGQLDVLPIALNPSIQRLVIKSNKI 71
            |..:.|:      ...|.||  .||..|:|...|..|.|...:|..:|..:.             
Human     4 WLCVLSLPLLLLPAAPPPAG--GCPARCECTVQTRAVACTRRRLTAVPDGIP------------- 53

  Fly    72 KTIDSSIQFYAELTFLDLSSNHLMTIPQRTFAYQKKLQEVHLNHNKIGQISNKTFIGLSAVTVLN 136
                      ||...|:||.|.:..:.....|....|:|:.|:.|.|..:....|..|..:.||.
Human    54 ----------AETRLLELSRNRIRCLNPGDLAALPALEELDLSENAIAHVEPGAFANLPRLRVLR 108

  Fly   137 LRGNQISELHQGTFTPLLKIEELNLGENRIGYLDPKAFDGLSQLRILYLDDNALTTVPDPVIFQA 201
            |||||:..:..|.||.|..:..|:|.||::..|....|..|..||.|.:.||.|..|.... |..
Human   109 LRGNQLKLIPPGVFTRLDNLTLLDLSENKLVILLDYTFQDLHSLRRLEVGDNDLVFVSRRA-FAG 172

  Fly   202 MPSLAELFLGMNTLQSIQADAFQDLKGLTRLELKGASLRNISHDSFL---GLQELRI-------- 255
            :.:|.||.|....|.::..::...|:.|..|.|:..::.::...:|.   ||..|.|        
Human   173 LLALEELTLERCNLTALSGESLGHLRSLGALRLRHLAIASLEDQNFRRLPGLLHLEIDNWPLLEE 237

  Fly   256 -------------LDLSDNRLDRIPSVGLSKLVRLEQLSLGQNDFEVISEGAFMGLKQLKRLEVN 307
                         |.::...:..:|:..|.....|..|:|..|....:..|:|..|.:|:.|.:.
Human   238 VAAGSLRGLNLTSLSVTHTNITAVPAAALRHQAHLTCLNLSHNPISTVPRGSFRDLVRLRELHLA 302

  Fly   308 GALRLKRVMTGAFSDNGNLEYLNLSSNKMLLEVQEGALSGLSQLKHVVLKANALTSLAEGLF-PW 371
            |||                          |..|:..|..||.|::.:.|..|.|::|.|..| ..
Human   303 GAL--------------------------LAVVEPQAFLGLRQIRLLNLSNNLLSTLEESTFHSV 341

  Fly   372 KDLQTLDLSENPLSCDCRVMWLHNLLVAKNASQDDVSEL-LCEFPERLRGESLRHLNPAMM---- 431
            ..|:||.:..|||:||||::|    :|.:..:.:....| .|..|..:||::||:|..:::    
Human   342 NTLETLRVDGNPLACDCRLLW----IVQRRKTLNFDGRLPACATPAEVRGDALRNLPDSVLFEYF 402

  Fly   432 GCTHADPRKQALIGALLVGSAATITALALVLYRCR 466
            .|.....|::.|       ...|.||...|.:.||
Human   403 VCRKPKIRERRL-------QRVTATAGEDVRFLCR 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380 0/17 (0%)
LRR_8 83..142 CDD:290566 19/58 (33%)
leucine-rich repeat 84..107 CDD:275380 5/22 (23%)
leucine-rich repeat 108..131 CDD:275380 7/22 (32%)
LRR_RI 129..421 CDD:238064 84/317 (26%)
LRR_8 132..190 CDD:290566 23/57 (40%)
leucine-rich repeat 132..155 CDD:275380 11/22 (50%)
leucine-rich repeat 156..179 CDD:275380 7/22 (32%)
leucine-rich repeat 180..204 CDD:275380 8/23 (35%)
LRR_8 203..263 CDD:290566 15/83 (18%)
leucine-rich repeat 205..228 CDD:275380 6/22 (27%)
leucine-rich repeat 229..252 CDD:275380 6/25 (24%)
LRR_8 252..308 CDD:290566 14/76 (18%)
leucine-rich repeat 253..276 CDD:275380 5/43 (12%)
leucine-rich repeat 277..300 CDD:275380 7/22 (32%)
leucine-rich repeat 301..322 CDD:275380 5/20 (25%)
LRR_8 325..384 CDD:290566 16/59 (27%)
leucine-rich repeat 326..350 CDD:275380 5/23 (22%)
leucine-rich repeat 351..373 CDD:275380 6/22 (27%)
LINGO3NP_001094861.1 LRRNT 24..58 CDD:214470 11/56 (20%)
LRR 1 55..76 5/20 (25%)
LRR_8 57..138 CDD:290566 27/80 (34%)
LRR_4 59..95 CDD:289563 10/35 (29%)
leucine-rich repeat 59..79 CDD:275380 5/19 (26%)
LRR 2 79..100 6/20 (30%)
leucine-rich repeat 80..103 CDD:275380 7/22 (32%)
LRR 3 103..124 9/20 (45%)
leucine-rich repeat 104..127 CDD:275380 11/22 (50%)
LRR_RI 111..>286 CDD:238064 43/175 (25%)
LRR_8 127..>172 CDD:290566 15/45 (33%)
LRR 4 127..148 6/20 (30%)
leucine-rich repeat 128..151 CDD:275380 7/22 (32%)
LRR 5 151..172 8/21 (38%)
leucine-rich repeat 152..199 CDD:275380 14/47 (30%)
LRR 6 175..196 5/20 (25%)
LRR_8 198..258 CDD:290566 9/59 (15%)
leucine-rich repeat 200..223 CDD:275380 4/22 (18%)
LRR 7 207..228 3/20 (15%)
leucine-rich repeat 224..247 CDD:275380 3/22 (14%)
LRR_8 247..303 CDD:290566 12/55 (22%)
LRR 8 247..268 3/20 (15%)
leucine-rich repeat 248..271 CDD:275380 3/22 (14%)
LRR 9 271..292 6/20 (30%)
leucine-rich repeat 272..293 CDD:275380 6/20 (30%)
LRR 10 295..316 8/46 (17%)
leucine-rich repeat 296..319 CDD:275380 10/48 (21%)
LRR 11 319..340 7/20 (35%)
leucine-rich repeat 322..343 CDD:275380 6/20 (30%)
I-set 407..497 CDD:254352 8/31 (26%)
Ig 422..490 CDD:299845 3/9 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6410
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.