| Sequence 1: | NP_001261796.1 | Gene: | trn / 39491 | FlyBaseID: | FBgn0010452 | Length: | 751 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001702.1 | Gene: | BGN / 633 | HGNCID: | 1044 | Length: | 368 | Species: | Homo sapiens |
| Alignment Length: | 288 | Identity: | 86/288 - (29%) |
|---|---|---|---|
| Similarity: | 144/288 - (50%) | Gaps: | 21/288 - (7%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 28 ANCPPGCQCDDNTLVVQCGEGQLDVLPIALNPSIQRLVIKSNKIKTI-DSSIQFYAELTFLDLSS 91
Fly 92 NHLMTIPQRTFAYQKKLQEVHLNHNKIGQISNKTFIGLSAVTVLNLRGNQISELHQGTFTPLLKI 156
Fly 157 EELNLGENRI---GYLDPKAFDGLSQLRILYLDDNALTTVPDPVIFQAMP-SLAELFLGMNTLQS 217
Fly 218 IQADAFQDLKGLTRLELKGASLRNISHDSFLGLQELRILDLSDNRLDRIPSVGLSKLVRLEQLSL 282
Fly 283 GQNDFEVISEGAF--MGLKQLKRLEVNG 308 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| trn | NP_001261796.1 | leucine-rich repeat | 62..80 | CDD:275380 | 3/18 (17%) |
| LRR_8 | 83..142 | CDD:290566 | 14/58 (24%) | ||
| leucine-rich repeat | 84..107 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 108..131 | CDD:275380 | 4/22 (18%) | ||
| LRR_RI | 129..421 | CDD:238064 | 59/186 (32%) | ||
| LRR_8 | 132..190 | CDD:290566 | 17/60 (28%) | ||
| leucine-rich repeat | 132..155 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 156..179 | CDD:275380 | 9/25 (36%) | ||
| leucine-rich repeat | 180..204 | CDD:275380 | 6/24 (25%) | ||
| LRR_8 | 203..263 | CDD:290566 | 21/60 (35%) | ||
| leucine-rich repeat | 205..228 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 229..252 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 252..308 | CDD:290566 | 20/57 (35%) | ||
| leucine-rich repeat | 253..276 | CDD:275380 | 12/22 (55%) | ||
| leucine-rich repeat | 277..300 | CDD:275380 | 6/24 (25%) | ||
| leucine-rich repeat | 301..322 | CDD:275380 | 4/8 (50%) | ||
| LRR_8 | 325..384 | CDD:290566 | |||
| leucine-rich repeat | 326..350 | CDD:275380 | |||
| leucine-rich repeat | 351..373 | CDD:275380 | |||
| BGN | NP_001702.1 | NEL | <64..>297 | CDD:330839 | 72/245 (29%) |
| leucine-rich repeat | 71..91 | CDD:275380 | 6/19 (32%) | ||
| LRR 1 | 82..102 | 4/19 (21%) | |||
| leucine-rich repeat | 92..115 | CDD:275380 | 3/22 (14%) | ||
| LRR 2 | 103..126 | 4/22 (18%) | |||
| leucine-rich repeat | 116..139 | CDD:275380 | 6/22 (27%) | ||
| LRR 3 | 127..150 | 6/22 (27%) | |||
| leucine-rich repeat | 140..160 | CDD:275380 | 4/22 (18%) | ||
| LRR 4 | 151..171 | 4/22 (18%) | |||
| leucine-rich repeat | 161..184 | CDD:275380 | 6/22 (27%) | ||
| LRR 5 | 172..195 | 5/22 (23%) | |||
| leucine-rich repeat | 185..208 | CDD:275380 | 7/23 (30%) | ||
| LRR 6 | 196..220 | 9/25 (36%) | |||
| leucine-rich repeat | 210..231 | CDD:275380 | 6/25 (24%) | ||
| LRR 7 | 221..241 | 8/24 (33%) | |||
| leucine-rich repeat | 233..254 | CDD:275380 | 6/20 (30%) | ||
| LRR 8 | 242..265 | 6/22 (27%) | |||
| leucine-rich repeat | 255..278 | CDD:275380 | 8/22 (36%) | ||
| LRR 9 | 266..289 | 9/22 (41%) | |||
| LRR_8 | 277..>323 | CDD:316378 | 16/46 (35%) | ||
| LRR 10 | 290..312 | 9/22 (41%) | |||
| leucine-rich repeat | 302..315 | CDD:275378 | 3/12 (25%) | ||
| LRR 11 | 313..342 | 7/23 (30%) | |||
| LRR 12 | 343..368 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||