DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trn and Tollo

DIOPT Version :9

Sequence 1:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_524757.1 Gene:Tollo / 44497 FlyBaseID:FBgn0029114 Length:1346 Species:Drosophila melanogaster


Alignment Length:381 Identity:113/381 - (29%)
Similarity:183/381 - (48%) Gaps:47/381 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 CGE--GQLDV-------LPIALNPSIQRLVIKSNKIKTIDSSIQFYAELTF--------LDLSSN 92
            ||.  ..||:       ||.|:..::.||    ..:....:|:.|.|:..|        :|||:|
  Fly   208 CGSTLQSLDLSANKMVSLPTAMLSALGRL----THLNMAKNSMSFLADRAFEGLLSLRVVDLSAN 268

  Fly    93 HLMTIPQRTFAYQKKLQEVHLNHNKIGQISNKTFIGLSAVTVLNLRGNQISE--LHQGTFTPLLK 155
            .|.::|...||..|:|||::|.:|.|..::...|..|:.:.||:|..|:::.  ::..||..|.:
  Fly   269 RLTSLPPELFAETKQLQEIYLRNNSINVLAPGIFGELAELLVLDLASNELNSQWINAATFVGLKR 333

  Fly   156 IEELNLGENRIGYLDPKAFDGLSQLRILYLDDNALTTVPDPVIFQAMPSLAELFLGMNTLQSIQA 220
            :..|:|..|:|..|:...|..|:.|:||.|:||.:..:|.. ||..:.:|..|.|..|.:..|:.
  Fly   334 LMMLDLSANKISRLEAHIFRPLASLQILKLEDNYIDQLPGG-IFADLTNLHTLILSRNRISVIEQ 397

  Fly   221 DAFQDLKGLTRLELKGASLRNISHDSFLGLQELRILDLSDNRLDRIPSVGLSKLVRLEQLSLGQN 285
            ...|.||.|..|.|....:..:...|.:...:|:.|.|:||:|..:|. .|:.:..|:.|.:|:|
  Fly   398 RTLQGLKNLLVLSLDFNRISRMDQRSLVNCSQLQDLHLNDNKLQAVPE-ALAHVQLLKTLDVGEN 461

  Fly   286 DFEVISEGAFMGLKQL--KRLEVNGALRLKRVMTGAFSDNGNLEYLNLSSNKMLLEVQEGALSGL 348
            ....|...:...|:.|  .|:..|....::|   |.|....:|:.||||.|| |..::.|:|...
  Fly   462 MISQIENTSITQLESLYGLRMTENSLTHIRR---GVFDRMSSLQILNLSQNK-LKSIEAGSLQRN 522

  Fly   349 SQLKHVVLKANALTSLAEGLFP------WKD-----LQTLDLSENPLSCDCRVMWL 393
            |||:.:.|..|.|.|:| |||.      |.:     |:..|.|..|:.    :.||
  Fly   523 SQLQAIRLDGNQLKSIA-GLFTELPNLVWLNISGNRLEKFDYSHIPIG----LQWL 573

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380 3/17 (18%)
LRR_8 83..142 CDD:290566 22/66 (33%)
leucine-rich repeat 84..107 CDD:275380 9/30 (30%)
leucine-rich repeat 108..131 CDD:275380 8/22 (36%)
LRR_RI 129..421 CDD:238064 84/280 (30%)
LRR_8 132..190 CDD:290566 20/59 (34%)
leucine-rich repeat 132..155 CDD:275380 7/24 (29%)
leucine-rich repeat 156..179 CDD:275380 7/22 (32%)
leucine-rich repeat 180..204 CDD:275380 9/23 (39%)
LRR_8 203..263 CDD:290566 17/59 (29%)
leucine-rich repeat 205..228 CDD:275380 7/22 (32%)
leucine-rich repeat 229..252 CDD:275380 4/22 (18%)
LRR_8 252..308 CDD:290566 16/57 (28%)
leucine-rich repeat 253..276 CDD:275380 8/22 (36%)
leucine-rich repeat 277..300 CDD:275380 6/22 (27%)
leucine-rich repeat 301..322 CDD:275380 6/22 (27%)
LRR_8 325..384 CDD:290566 25/69 (36%)
leucine-rich repeat 326..350 CDD:275380 10/23 (43%)
leucine-rich repeat 351..373 CDD:275380 10/27 (37%)
TolloNP_524757.1 LRR_RI <85..281 CDD:238064 21/76 (28%)
leucine-rich repeat 100..123 CDD:275380
leucine-rich repeat 124..144 CDD:275380
LRR_8 152..222 CDD:290566 4/13 (31%)
leucine-rich repeat 154..177 CDD:275380
leucine-rich repeat 178..201 CDD:275380
LRR 210..656 CDD:227223 111/379 (29%)
leucine-rich repeat 212..235 CDD:275380 5/22 (23%)
leucine-rich repeat 236..259 CDD:275380 5/26 (19%)
leucine-rich repeat 260..283 CDD:275380 8/22 (36%)
LRR_RI 276..558 CDD:238064 88/288 (31%)
leucine-rich repeat 284..307 CDD:275380 8/22 (36%)
leucine-rich repeat 308..333 CDD:275380 7/24 (29%)
leucine-rich repeat 334..357 CDD:275380 7/22 (32%)
leucine-rich repeat 358..381 CDD:275380 9/23 (39%)
leucine-rich repeat 382..405 CDD:275380 7/22 (32%)
leucine-rich repeat 406..429 CDD:275380 4/22 (18%)
leucine-rich repeat 430..452 CDD:275380 8/22 (36%)
leucine-rich repeat 453..500 CDD:275380 12/49 (24%)
leucine-rich repeat 501..521 CDD:275380 10/20 (50%)
leucine-rich repeat 525..547 CDD:275380 9/22 (41%)
leucine-rich repeat 548..573 CDD:275380 5/28 (18%)
leucine-rich repeat 604..640 CDD:275380
leucine-rich repeat 641..688 CDD:275380
leucine-rich repeat 689..816 CDD:275380
LRR_8 815..875 CDD:290566
leucine-rich repeat 817..864 CDD:275380
LRR_8 864..921 CDD:290566
leucine-rich repeat 865..888 CDD:275380
leucine-rich repeat 889..910 CDD:275380
TIR 1076..1211 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453507
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.