DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trn and CG7896

DIOPT Version :10

Sequence 1:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_651754.1 Gene:CG7896 / 43552 FlyBaseID:FBgn0039728 Length:1392 Species:Drosophila melanogaster


Alignment Length:700 Identity:159/700 - (22%)
Similarity:265/700 - (37%) Gaps:196/700 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LNP-----------SIQRLVIKSNKIKTIDSSI--------QFYAE-----------------LT 85
            |||           :::.|.:..||||.|:..:        :||.:                 |.
  Fly   147 LNPIFSTAELHVLKNLRLLDLSGNKIKLIEEGLLKGCMDLKEFYIDRNSLTSVPTNSLNGPSALR 211

  Fly    86 FLDLSSNHLMTIPQRTFAYQKKLQEVHLNHNKIGQISNKTFIGLSAVTVLNLRGNQISELHQGTF 150
            .|.|..|.:.::...:|..|::|:.:.|.||.|..|.:..|.||..:..:.|.||:||.|:...|
  Fly   212 HLSLRQNQIGSLLADSFNAQRQLEIIDLRHNVIRSIDSLAFKGLQKIREIKLAGNRISHLNSDVF 276

  Fly   151 TPLLKIEELNLGENRIGYLDPKAFDGLSQLRILYLDDNALTTVPDPVIFQAMPSLAELFLGMNTL 215
            ..|..:::|:|.||..|.....|...:..|:.|.|..|.|..: |....|.:.||..|.:..||:
  Fly   277 EKLQSLQKLDLSENFFGQFPTVALAAVPGLKHLNLSSNMLQQL-DYTHMQVVRSLESLDISRNTI 340

  Fly   216 QSIQADAFQDLKGLTRLELKGASLRNISHDSFLGLQELRILDLSDNRLDRIPSVGLSKLVRLEQL 280
            .:|....|:::..|..|:|...|||.|..|:..||..|:.|.:.||.:..:|...|.:|.:|..|
  Fly   341 TTITPGTFREMGALKYLDLSLNSLRTIEDDALEGLDSLQTLIIKDNNILLVPGSALGRLPQLTSL 405

  Fly   281 SLGQNDFEVISEGAFMGLKQLKRLEVNGALR-------------LKRVMTGAFSDNGNLEYLNLS 332
            .|..|....:|            .|:.|:|:             ::.:..|:|....:|..|:||
  Fly   406 QLDYNRVAALS------------AEILGSLQAGDITTLSLSRNVIRELPPGSFQMFSSLHTLDLS 458

  Fly   333 SNKMLLEVQEGALSGL-SQLKHVVLKANALTSLAEGLFPW--KDLQTLDLSENPLSCDCRVMWLH 394
            .|.:.: :.....:|| |.|..:.|..|.||.|  |..||  .:|::||||.|.|:         
  Fly   459 GNSLAV-INADTFAGLESTLMALKLSQNRLTGL--GGAPWVLPELRSLDLSGNTLT--------- 511

  Fly   395 NLLVAKNASQDDVSELLCEFPERLRGESLRHLNPAMMGCTHADPRKQALIGALLVGSAATITALA 459
                              |.|..: .|.|.::....:...|..|    |.|||.    ..:..|.
  Fly   512 ------------------ELPSTI-FEELENVQSLNLSGNHLTP----LTGALF----KPLDRLQ 549

  Fly   460 LV-LYRCRHKIRETIKGGLWGNSALGRKEREYQKTFCDEDYMSRHQHHPCSLGIHSTFPNTYTAP 523
            :: |..|  .||: |.|.|....      ::.:..:.:::.:...|        ..:|.|.:   
  Fly   550 VIDLSGC--NIRQ-ISGDLLAGL------QDLKHIYLNDNQLQELQ--------DGSFVNLW--- 594

  Fly   524 HHPGATHHYGMCPMPVNDLGAIDPQQKFQQLVVPTATMISEKKLNNNKALVSQGAIDDSASFVLH 588
                             ::.:||                    |:||:.    |:| .|.:||..
  Fly   595 -----------------NISSID--------------------LSNNRI----GSI-RSGAFVNV 617

  Fly   589 MKSATMGRDVHQQNPQLNHYTKPQFLSATA----TVGDSCYSYADVPMVHGAPLGGPNQPQLRLT 649
            ||...:  |:|  ..||:.:....|.:.|.    .:.|:..||.       .|......|:||..
  Fly   618 MKLQKL--DLH--GNQLSAFKGEYFNTGTGIEELDISDNQLSYL-------FPSSFRIHPRLREI 671

  Fly   650 QEHFKQRELYDQEMGSEI-------LDHNYIYSNTHYSMPLEQLGRSKTP 692
            :....:...:..|:.|.:       |.||.:.:       :|:|..::.|
  Fly   672 RAANNKFSFFPAELISTLQYLEHIDLSHNQLKT-------IEELDFARLP 714

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380 6/25 (24%)
LRR 82..406 CDD:443914 94/356 (26%)
leucine-rich repeat 84..107 CDD:275380 6/22 (27%)
leucine-rich repeat 108..131 CDD:275380 9/22 (41%)
leucine-rich repeat 132..155 CDD:275380 8/22 (36%)
leucine-rich repeat 156..179 CDD:275380 6/22 (27%)
leucine-rich repeat 180..204 CDD:275380 7/23 (30%)
leucine-rich repeat 205..228 CDD:275380 6/22 (27%)
leucine-rich repeat 229..252 CDD:275380 10/22 (45%)
leucine-rich repeat 253..276 CDD:275380 7/22 (32%)
leucine-rich repeat 277..300 CDD:275380 5/22 (23%)
leucine-rich repeat 301..322 CDD:275380 5/33 (15%)
leucine-rich repeat 326..350 CDD:275380 7/24 (29%)
leucine-rich repeat 351..373 CDD:275380 9/23 (39%)
LRRCT 382..434 CDD:214507 6/51 (12%)
CG7896NP_651754.1 PRK15370 20..>410 CDD:185268 74/263 (28%)
leucine-rich repeat 109..132 CDD:275380
leucine-rich repeat 133..161 CDD:275380 3/13 (23%)
leucine-rich repeat 162..185 CDD:275380 6/22 (27%)
leucine-rich repeat 186..209 CDD:275380 2/22 (9%)
leucine-rich repeat 210..233 CDD:275380 6/22 (27%)
leucine-rich repeat 234..257 CDD:275380 9/22 (41%)
PLN00113 237..>750 CDD:215061 140/609 (23%)
leucine-rich repeat 258..281 CDD:275380 8/22 (36%)
leucine-rich repeat 282..329 CDD:275380 13/47 (28%)
leucine-rich repeat 330..353 CDD:275380 6/22 (27%)
leucine-rich repeat 354..377 CDD:275380 10/22 (45%)
leucine-rich repeat 378..401 CDD:275380 7/22 (32%)
leucine-rich repeat 402..425 CDD:275380 8/34 (24%)
leucine-rich repeat 428..451 CDD:275380 2/22 (9%)
leucine-rich repeat 452..473 CDD:275380 5/21 (24%)
leucine-rich repeat 477..497 CDD:275378 9/21 (43%)
leucine-rich repeat 500..523 CDD:275380 11/50 (22%)
leucine-rich repeat 524..547 CDD:275380 6/30 (20%)
leucine-rich repeat 548..571 CDD:275380 8/31 (26%)
leucine-rich repeat 572..595 CDD:275380 3/50 (6%)
leucine-rich repeat 596..619 CDD:275380 10/47 (21%)
leucine-rich repeat 620..643 CDD:275380 5/26 (19%)
leucine-rich repeat 644..667 CDD:275380 4/29 (14%)
leucine-rich repeat 668..691 CDD:275380 4/22 (18%)
LRR <684..1020 CDD:443914 7/37 (19%)
leucine-rich repeat 692..715 CDD:275380 5/29 (17%)
leucine-rich repeat 716..739 CDD:275380
leucine-rich repeat 740..761 CDD:275380
leucine-rich repeat 764..789 CDD:275380
leucine-rich repeat 790..810 CDD:275380
leucine-rich repeat 818..850 CDD:275380
leucine-rich repeat 863..883 CDD:275378
leucine-rich repeat 884..907 CDD:275380
leucine-rich repeat 908..933 CDD:275380
leucine-rich repeat 934..955 CDD:275380
leucine-rich repeat 958..982 CDD:275380
leucine-rich repeat 983..1055 CDD:275380
leucine-rich repeat 1009..1033 CDD:275380
leucine-rich repeat 1058..1085 CDD:275380
LRRCT 1121..1168 CDD:214507
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.