DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trn and Tl

DIOPT Version :10

Sequence 1:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001262995.1 Gene:Tl / 43222 FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster


Alignment Length:470 Identity:116/470 - (24%)
Similarity:195/470 - (41%) Gaps:103/470 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DNTLVVQCGEGQLDVLPIAL---NPSIQRLVIKSNKIKTI-----------------DSSIQ--- 79
            :|...::.|..:|..:|..:   .|.:::|.:.||::..:                 |:.|:   
  Fly   197 ENLESIEFGSNKLRQMPRGIFGKMPKLKQLNLWSNQLHNLTKHDFEGATSVLGIDIHDNGIEQLP 261

  Fly    80 --FYAEL---TFLDLSSNHLMTIPQRTFAYQKKLQEVHLNHNKI--GQISNKTFIGLSAVTVLNL 137
              .:|.|   |.::||:|...::||..|.:.|.|.||.|.:|::  ..:.::.|.....:.:|.|
  Fly   262 HDVFAHLTNVTDINLSANLFRSLPQGLFDHNKHLNEVRLMNNRVPLATLPSRLFANQPELQILRL 326

  Fly   138 RGNQISELHQGTFTPLLKIEELNLGENRIGYLDPKAFDGLSQLRILYLDDNALTTVPDPVIFQAM 202
            |. ::..|....|....:|..::||:|.:..|.....:....|..|.|.:|.||.:||. :|...
  Fly   327 RA-ELQSLPGDLFEHSTQITNISLGDNLLKTLPATLLEHQVNLLSLDLSNNRLTHLPDS-LFAHT 389

  Fly   203 PSLAELFLGMNTLQSIQADAFQDLKGLTRLELKGASLRNISHDSFLGLQELRILDLSDNRLD--- 264
            .:|.:|.|..|.|..|..|.|.:|..|..|.:....||.|...:|:....||.|.|..|.:|   
  Fly   390 TNLTDLRLEDNLLTGISGDIFSNLGNLVTLVMSRNRLRTIDSRAFVSTNGLRHLHLDHNDIDLQQ 454

  Fly   265 ---------RIPSV-----GLSKL-VRLEQLSLGQNDFEVISEGAFMGLKQLKRLEVNGALRLKR 314
                     :|.|.     ||..| :|...:....||::                  |..|:|:.
  Fly   455 PLLDIMLQTQINSPFGYMHGLLTLNLRNNSIIFVYNDWK------------------NTMLQLRE 501

  Fly   315 VMTGAFSDNGNLEYLNLSSNKMLLEVQEGALSGLSQLK-HVVLKANALTSLA--------EGLFP 370
            :         :|.|.|:||    |..::  |:.|||.: ||.:..|.:..:|        ||.. 
  Fly   502 L---------DLSYNNISS----LGYED--LAFLSQNRLHVNMTHNKIRRIALPEDVHLGEGYN- 550

  Fly   371 WKDLQTLDLSENPLSCDCRVMWLHNLLVAKNASQDD------VSELLCEFPERLRGESLRHLNPA 429
             .:|..:||::|||.|||.::|...|:...:..|..      ...|:|..|..|.|..:|.:.|.
  Fly   551 -NNLVHVDLNDNPLVCDCTILWFIQLVRGVHKPQYSRQFKLRTDRLVCSQPNVLEGTPVRQIEPQ 614

  Fly   430 MMGCT---HADPRKQ 441
            .:.|.   ..|||::
  Fly   615 TLICPLDFSDDPRER 629

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380 5/39 (13%)
LRR 82..406 CDD:443914 95/355 (27%)
leucine-rich repeat 84..107 CDD:275380 8/25 (32%)
leucine-rich repeat 108..131 CDD:275380 6/24 (25%)
leucine-rich repeat 132..155 CDD:275380 5/22 (23%)
leucine-rich repeat 156..179 CDD:275380 5/22 (23%)
leucine-rich repeat 180..204 CDD:275380 9/23 (39%)
leucine-rich repeat 205..228 CDD:275380 9/22 (41%)
leucine-rich repeat 229..252 CDD:275380 6/22 (27%)
leucine-rich repeat 253..276 CDD:275380 11/40 (28%)
leucine-rich repeat 277..300 CDD:275380 2/22 (9%)
leucine-rich repeat 301..322 CDD:275380 3/20 (15%)
leucine-rich repeat 326..350 CDD:275380 8/23 (35%)
leucine-rich repeat 351..373 CDD:275380 6/30 (20%)
LRRCT 382..434 CDD:214507 16/57 (28%)
TlNP_001262995.1 LRR_8 174..233 CDD:404697 8/35 (23%)